Recombinant Full Length Escherichia Coli Sensor Protein Uhpb(Uhpb) Protein, His-Tagged
Cat.No. : | RFL2451EF |
Product Overview : | Recombinant Full Length Escherichia coli Sensor protein uhpB(uhpB) Protein (P09835) (1-500aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-500) |
Form : | Lyophilized powder |
AA Sequence : | MKTLFSRLITVIACFFIFSAAWFCLWSISLHLVERPDMAVLLFPFGLRLGLMLQCPRGYW PVLLGAEWLLIYWLTQAVGLTHFPLLMIGSLLTLLPVALISRYRHQRDWRTLLLQGAALT AAALLQSLPWLWHGKESWNALLLTLTGGLTLAPICLVFWHYLANNTWLPLGPSLVSQPIN WRGRHLVWYLLLFVISLWLQLGLPDELSRFTPFCLALPIIALAWHYGWQGALIATLMNAI ALIASQTWRDHPVDLLLSLLVQSLTGLLLGAGIQRLRELNQSLQKELARNQHLAERLLET EESVRRDVARELHDDIGQTITAIRTQAGIVQRLAADNASVKQSGQLIEQLSLGVYDAVRR LLGRLRPRQLDDLTLEQAIRSLMREMELEGRGIVSHLEWRIDESALSENQRVTLFRVCQE GLNNIVKHADASAVTLQGWQQDERLMLVIEDDGSGLPPGSGQQGFGLTGMRERVTALGGT LHISCLHGTRVSVSLPQRYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uhpB |
Synonyms | uhpB; b3668; JW3643; Signal transduction histidine-protein kinase/phosphatase UhpB |
UniProt ID | P09835 |
◆ Recombinant Proteins | ||
HVCN1-494Z | Recombinant Zebrafish HVCN1 | +Inquiry |
SWSAP1-5416H | Recombinant Human SWSAP1 Protein (Met1-Pro229), N-His tagged | +Inquiry |
RFL23426MF | Recombinant Full Length Mouse Coiled-Coil Domain-Containing Protein 107(Ccdc107) Protein, His-Tagged | +Inquiry |
AVPR1A-1285R | Recombinant Rat AVPR1A Protein (7-52 aa), GST-tagged | +Inquiry |
AYP1020-RS04605-6034S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS04605 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-259H | Native Human Secretory Immunoglobulin A | +Inquiry |
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
MUC19-185B | Native Bovine Mucin Protein | +Inquiry |
IgG-159B | Native Bovine Immunoglobulin G | +Inquiry |
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL10-8723HCL | Recombinant Human ARL10 293 Cell Lysate | +Inquiry |
Spleen-466H | Human Spleen Liver Cirrhosis Lysate | +Inquiry |
HA-005H7N9CL | Recombinant H7N9 HA cell lysate | +Inquiry |
IL1RAPL2-2913HCL | Recombinant Human IL1RAPL2 cell lysate | +Inquiry |
HA-1479HCL | Recombinant H10N9 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uhpB Products
Required fields are marked with *
My Review for All uhpB Products
Required fields are marked with *
0
Inquiry Basket