Recombinant Rat AVPR1A Protein (7-52 aa), GST-tagged

Cat.No. : AVPR1A-1285R
Product Overview : Recombinant Rat AVPR1A Protein (7-52 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : GST
Protein Length : 7-52 aa
Description : Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. Involved in social mory formation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.9 kDa
AA Sequence : SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name Avpr1a arginine vasopressin receptor 1A [ Rattus norvegicus ]
Official Symbol AVPR1A
Synonyms AVPR1A; V1a; AVPR; V1aR; MGC108538;
Gene ID 25107
mRNA Refseq NM_053019
Protein Refseq NP_444178
UniProt ID P30560

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AVPR1A Products

Required fields are marked with *

My Review for All AVPR1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon