Recombinant Full Length Escherichia Coli Rhomboid Protease Glpg(Glpg) Protein, His-Tagged
Cat.No. : | RFL21567EF |
Product Overview : | Recombinant Full Length Escherichia coli Rhomboid protease glpG(glpG) Protein (B1IP42) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glpG |
Synonyms | glpG; EcolC_0290; Rhomboid protease GlpG; Intramembrane serine protease |
UniProt ID | B1IP42 |
◆ Recombinant Proteins | ||
FRY-3369M | Recombinant Mouse FRY Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP3K5-7528Z | Recombinant Zebrafish MAP3K5 | +Inquiry |
HMMR-195H | Recombinant Human HMMR Protein, His-tagged | +Inquiry |
TP73-AS1-152H | Recombinant Human TP73-AS1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GRHL1-3920M | Recombinant Mouse GRHL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ACPP-29981TH | Native Human ACPP | +Inquiry |
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
TF-143C | Native Chicken Serum Transferrin | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPM-7580HCL | Recombinant Human CENPM 293 Cell Lysate | +Inquiry |
ANAPC5-74HCL | Recombinant Human ANAPC5 cell lysate | +Inquiry |
ENTPD1-431MCL | Recombinant Mouse ENTPD1 cell lysate | +Inquiry |
RRM1-001HCL | Recombinant Human RRM1 cell lysate | +Inquiry |
CA10-1810MCL | Recombinant Mouse CA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All glpG Products
Required fields are marked with *
My Review for All glpG Products
Required fields are marked with *
0
Inquiry Basket