Recombinant Full Length Klebsiella Pneumoniae Subsp. Pneumoniae Rhomboid Protease Glpg(Glpg) Protein, His-Tagged
Cat.No. : | RFL4106KF |
Product Overview : | Recombinant Full Length Klebsiella pneumoniae subsp. pneumoniae Rhomboid protease glpG(glpG) Protein (A6TF43) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Klebsiella Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MLMITSFANPRVAQAFVDYMATQGIILTIQQHTQSDVWLADESQAGRVRAELARFLENPA DPRYLAASWQSGQTNSGLRYQRFPFFATLRHNAGPFTWAILLICIAVFILQNLLGDQPVM IWLAWPYDPSLQFEAWRYFSHAFMHFSLMHILFNLLWWWYLGGAVEKRIGSGKLVVITVI SALLSGFVQHQFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLILFSLVWLIAG WFDVFGMAIANGAHVAGLATGLAMAFVDTLHGRKRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glpG |
Synonyms | glpG; KPN78578_37530; KPN_03790; Rhomboid protease GlpG; Intramembrane serine protease |
UniProt ID | A6TF43 |
◆ Recombinant Proteins | ||
ABCA9-7644H | Recombinant Human ABCA9 protein, GST-tagged | +Inquiry |
ODF3B-10324Z | Recombinant Zebrafish ODF3B | +Inquiry |
RFL17803PF | Recombinant Full Length Pongo Pygmaeus Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged | +Inquiry |
BCKDHA-3020Z | Recombinant Zebrafish BCKDHA | +Inquiry |
PGK1-30891TH | Recombinant Human PGK1 | +Inquiry |
◆ Native Proteins | ||
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
HbA1c-21R | Native Rhesus monkey Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
VTN-31735TH | Native Human VTN | +Inquiry |
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-001H3N2CL | Recombinant H3N2 HA cell lysate | +Inquiry |
EMP1-6607HCL | Recombinant Human EMP1 293 Cell Lysate | +Inquiry |
PSMB1-2775HCL | Recombinant Human PSMB1 293 Cell Lysate | +Inquiry |
PRIMPOL-7789HCL | Recombinant Human CCDC111 293 Cell Lysate | +Inquiry |
GLUL-5890HCL | Recombinant Human GLUL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All glpG Products
Required fields are marked with *
My Review for All glpG Products
Required fields are marked with *
0
Inquiry Basket