Recombinant Full Length Escherichia Coli Putative Membrane Protein Igaa Homolog(Yrff) Protein, His-Tagged
Cat.No. : | RFL33241EF |
Product Overview : | Recombinant Full Length Escherichia coli Putative membrane protein igaA homolog(yrfF) Protein (P45800) (1-711aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-711) |
Form : | Lyophilized powder |
AA Sequence : | MSTIVIFLAALLACSLLAGWLIKVRSRRRQLPWTNAFADAQTRKLTPEERSAVENYLESL TQVLQVPGPTGASAAPISLALNAESNNVMMLTHAITRYGISTDDPNKWRYYLDSVEVHLP PFWEQYINDENTVELIHTDSLPLVISLNGHTLQEYMQETRSYALQPVPSTQASIRGEESE QIELLNIRKETHEEYALSRPRGLREALLIVASFLMFFFCLITPDVFVPWLAGGALLLLGA GLWGLFAPPAKSSLREIHCLRGTPRRWGLFGENDQEQINNISLGIIDLVYPAHWQPYIAQ DLGQQTDIDIYLDRHVVRQGRYLSLHDEVKNFPLQHWLRSTIIAAGSLLVLFMLLFWIPL DMPLKFTLSWMKGAQTIEATSVKQLADAGVRVGDTLRISGTGMCNIRTSGTWSAKTNSPF LPFDCSQIIWNDARSLPLPESELVNKATALTEAVNRQLHPKPEDESRVSASLRSAIQKSG MVLLDDFGDIVLKTADLCSAKDDCVRLKNALVNLGNSKDWDALVKRANAGKLDGVNVLLR PVSAESLDNLVATSTAPFITHETARAAQSLNSPAPGGFLIVSDEGSDFVDQPWPSASLYD YPPQEQWNAFQKLAQMLMHTPFNAEGIVTKIFTDANGTQHIGLHPIPDRSGLWRYLSTTL LLLTMLGSAIYNGVQAWRRYQRHRTRMMEIQAYYESCLNPQLITPSESLIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yrfF |
Synonyms | yrfF; b3398; JW3361; Putative membrane protein IgaA homolog |
UniProt ID | P45800 |
◆ Recombinant Proteins | ||
DMBX1B-2396Z | Recombinant Zebrafish DMBX1B | +Inquiry |
RFL29113BF | Recombinant Full Length Bovine Pdzk1-Interacting Protein 1(Pdzk1Ip1) Protein, His-Tagged | +Inquiry |
CSF1-1962H | Recombinant Human CSF1 Protein, GST-tagged | +Inquiry |
RPS18-297H | Recombinant Human ribosomal protein S18, His-tagged | +Inquiry |
RFL35395NF | Recombinant Full Length Nymphaea Alba Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HBA2-27784TH | Native Human HBA2 | +Inquiry |
MYH-11R | Active Native Rabbit Myosin II Protein | +Inquiry |
TF-143C | Native Chicken Serum Transferrin | +Inquiry |
HPX-206H | Native Human Native Human HPX | +Inquiry |
Immunoglobulin A2-78H | Native Human Immunoglobulin A2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGBD1-3260HCL | Recombinant Human PGBD1 293 Cell Lysate | +Inquiry |
HMGB3-801HCL | Recombinant Human HMGB3 cell lysate | +Inquiry |
RRAS-2144HCL | Recombinant Human RRAS 293 Cell Lysate | +Inquiry |
GPBP1-303HCL | Recombinant Human GPBP1 lysate | +Inquiry |
A-20-HL | Human A-20 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yrfF Products
Required fields are marked with *
My Review for All yrfF Products
Required fields are marked with *
0
Inquiry Basket