Recombinant Full Length Escherichia Coli Phosphotransferase Enzyme Iib Component Glvb(Glvb) Protein, His-Tagged
Cat.No. : | RFL17897EF |
Product Overview : | Recombinant Full Length Escherichia coli Phosphotransferase enzyme IIB component glvB(glvB) Protein (P69789) (1-161aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-161) |
Form : | Lyophilized powder |
AA Sequence : | MFSNHADMMLTQIAIGLCFTLLYFVVFRTLILQFNMCTPGREDAEVKLYSKAEYKASRGQ TTAAEPKKELDQAAGILQALGGVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGV FRSGDAIQVIIGLHVSQLREQLDSLINSHQSAENVAITEAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | glvB |
Synonyms | glvB; glvC; yidN; b3682; JW3659; Phosphotransferase enzyme IIB component GlvB; PTS system EIIB component |
UniProt ID | P69789 |
◆ Recombinant Proteins | ||
EFHB-2666M | Recombinant Mouse EFHB Protein, His (Fc)-Avi-tagged | +Inquiry |
PRL-96B | Recombinant Bovine PRL protein, His-tagged | +Inquiry |
HMX2-2112R | Recombinant Rhesus monkey HMX2 Protein, His-tagged | +Inquiry |
METTL14-5491M | Recombinant Mouse METTL14 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cfb-2108R | Recombinant Rat Cfb protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C8-103H | Native Human C8 Protein | +Inquiry |
PLG-30879TH | Native Human PLG | +Inquiry |
CAPN1-65P | Active Native Porcine Porcine Calpain 1 | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FIGF-1312MCL | Recombinant Mouse FIGF cell lysate | +Inquiry |
FAM186B-6399HCL | Recombinant Human FAM186B 293 Cell Lysate | +Inquiry |
PPP4R1L-1406HCL | Recombinant Human PPP4R1L cell lysate | +Inquiry |
NR5A1-3705HCL | Recombinant Human NR5A1 293 Cell Lysate | +Inquiry |
DSG4-6806HCL | Recombinant Human DSG4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All glvB Products
Required fields are marked with *
My Review for All glvB Products
Required fields are marked with *
0
Inquiry Basket