Recombinant Bovine PRL protein, His-tagged

• Cat.No.: PRL-96B
• Product Overview: Recombinant Bovine PRL protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Bovine
• Source: E.coli
• Tag: His
• Description: This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein.
• Form: 50mM Tris, 300mM NaCl, pH 8.0.
• Molecular Mass: 24 kDa
• AA Sequence: MGSSHHHHHHTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.25 mg/ml

Gene Information

• Gene Name: PRL prolactin [ Bos taurus (cattle) ]
• Official Symbol: PRL
• Synonyms: GHA1
• Gene ID: 280901
• mRNA Refseq: NM_173953
• Protein Refseq: NP_776378
• UniProt ID: P01239