Recombinant Full Length Escherichia Coli O6:K15:H31 Zinc Transporter Zupt(Zupt) Protein, His-Tagged
Cat.No. : | RFL1937EF |
Product Overview : | Recombinant Full Length Escherichia coli O6:K15:H31 Zinc transporter ZupT(zupT) Protein (Q0TD62) (1-257aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-257) |
Form : | Lyophilized powder |
AA Sequence : | MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zupT |
Synonyms | zupT; ECP_3134; Zinc transporter ZupT |
UniProt ID | Q0TD62 |
◆ Native Proteins | ||
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
LDL-401H | Native Human Low Density Lipoprotein, Medium Oxidized, DiI labeled | +Inquiry |
PAP-01H | Active Native Human PAP | +Inquiry |
Papain-149 | Active Native Immobilized Papain | +Inquiry |
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL50-4159HCL | Recombinant Human MRPL50 293 Cell Lysate | +Inquiry |
TRAPPC6A-805HCL | Recombinant Human TRAPPC6A 293 Cell Lysate | +Inquiry |
EDIL3-6722HCL | Recombinant Human EDIL3 293 Cell Lysate | +Inquiry |
FANCD2-270HCL | Recombinant Human FANCD2 lysate | +Inquiry |
Prostate-404C | Cynomolgus monkey Prostate Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zupT Products
Required fields are marked with *
My Review for All zupT Products
Required fields are marked with *
0
Inquiry Basket