Recombinant Full Length Rat Transmembrane Protein 209(Tmem209) Protein, His-Tagged
Cat.No. : | RFL24715RF |
Product Overview : | Recombinant Full Length Rat Transmembrane protein 209(Tmem209) Protein (Q68FR5) (1-561aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-561) |
Form : | Lyophilized powder |
AA Sequence : | MMQGEVSPSPSLIDRTIRMRKETESRKVVLAWGLLNVSMAGMIYTEMTGKLISTYYNVTY WPLWYIELALASLFSLNALFDFWRYFKYTVAPTSLVVSPGQQTLLGLKPAVVQTTPPRDL AATQISPSPPSPSIQGQSVLSYSPSRSPSTSPKFATSCMTGYSPQLQGLSSGGLGSYSPA VTYSPVSGYSKLASFSLSPSSPYPTTVGPVESSGLRARYRSPPTAYNSPTDKEDYMTDLR TLDTFLRSEEEKQHRVKLGSPDSTSPSTSPTFWNYSRSVGDYAQTLKKFQYQLACRSQAP CANKDEADLISKQAAEEVWARVTMNRQLLDHMDSWTAKFRNWISETILVPLVQEIESVST QMRRMGCPELQIGEASVTSLKQAALVKAPLIPTLNAIVQYLDLTPNQEYLFERIKELSQG GCMSSFRWNRGGDFKGRRWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFV QTPNKPDVTNENVFCVYQSAINPPHYELIYQRHVYSLPKGRNNMFHTLLMFLYIIKTKES GMLGRVNLGLSGVNILWIFGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem209 |
Synonyms | Tmem209; Transmembrane protein 209 |
UniProt ID | Q68FR5 |
◆ Recombinant Proteins | ||
FXN-1060M | Recombinant Cynomolgus Monkey FXN Protein (81-210 aa), His-tagged | +Inquiry |
1700021F07Rik-1379M | Recombinant Mouse 1700021F07Rik Protein, Myc/DDK-tagged | +Inquiry |
POLI-1834H | Recombinant Human POLI, His-tagged | +Inquiry |
DCN-1930H | Recombinant Human DCN protein(Met1-Lys359), His-tagged | +Inquiry |
RIPK3-2348H | Recombinant Full Length Human RIPK3 protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
Ferritin-179H | Native Human Ferritin | +Inquiry |
TGase-12S | Active Native Streptoverticillium mobaraense Transglutaminase Protein (Food Grade) | +Inquiry |
Fn1-5424M | Native Mouse Fibronectin | +Inquiry |
Small Intestine-014H | Human Small Intestine Lysate, Total Protein | +Inquiry |
CDA002 | Active Native Human MUC16 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BACE1-3006HCL | Recombinant Human BACE1 cell lysate | +Inquiry |
RNASE10-2324HCL | Recombinant Human RNASE10 293 Cell Lysate | +Inquiry |
LRRC29-4638HCL | Recombinant Human LRRC29 293 Cell Lysate | +Inquiry |
HA-2666HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
ANAPC11-8869HCL | Recombinant Human ANAPC11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem209 Products
Required fields are marked with *
My Review for All Tmem209 Products
Required fields are marked with *
0
Inquiry Basket