Recombinant Full Length Escherichia Coli O157:H7 Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL23184EF |
Product Overview : | Recombinant Full Length Escherichia coli O157:H7 Bifunctional protein aas(aas) Protein (B5Z4F4) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDPQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEVEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; ECH74115_4103; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; |
UniProt ID | B5Z4F4 |
◆ Recombinant Proteins | ||
YBFH-2607B | Recombinant Bacillus subtilis YBFH protein, His-tagged | +Inquiry |
BTN3A2-459H | Recombinant Human BTN3A2 protein, His-tagged | +Inquiry |
FAM160B2-3000M | Recombinant Mouse FAM160B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNNI3-02H | Recombinant Human TNNI3 Protein, His-Tagged | +Inquiry |
DENND5B-4342H | Recombinant Human DENND5B Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1748B | Active Native Bauhinia Purpurea Lectin Protein | +Inquiry |
IgD-213H | Native Human Immunoglobulin D (IgD) | +Inquiry |
IgM-208M | Native Monkey Immunoglobulin M | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
Lectin-1788G | Active Native Griffonia Simplicifolia Lectin II Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRTAP2-4-4846HCL | Recombinant Human KRTAP2 293 Cell Lysate | +Inquiry |
GPR151-740HCL | Recombinant Human GPR151 cell lysate | +Inquiry |
PIGX-3194HCL | Recombinant Human PIGX 293 Cell Lysate | +Inquiry |
Radish-706P | Radish Lysate, Total Protein | +Inquiry |
Adipose-7H | Human Adipose Visceral Diabetic Disease Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket