Recombinant Full Length Escherichia Coli Methyl-Accepting Chemotaxis Protein Iii(Trg) Protein, His-Tagged
Cat.No. : | RFL25612EF |
Product Overview : | Recombinant Full Length Escherichia coli Methyl-accepting chemotaxis protein III(trg) Protein (P05704) (1-546aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-546) |
Form : | Lyophilized powder |
AA Sequence : | MNTTPSQRLGFLHHIRLVPLFACILGGILVLFALSSALAGYFLWQADRDQRDVTAEIEIR TGLANSSDFLRSARINMIQAGAASRIAEMEAMKRNIAQAESEIKQSQQGYRAYQNRPVKT PADEALDTELNQRFQAYITGMQPMLKYAKNGMFEAIINHESEQIRPLDNAYTDILNKAVK IRSTRANQLAELAHQRTRLGGMFMIGAFVLALVMTLITFMVLRRIVIRPLQHAAQRIEKI ASGDLTMNDEPAGRNEIGRLSRHLQQMQHSLGMTVGTVRQGAEEIYRGTSEISAGNADLS SRTEEQAAAIEQTAASMEQLTATVKQNADNAHHASKLAQEASIKASDGGQTVSGVVKTMG AISTSSKKISEITAVINSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRTLASRSAQ AAKEIEGLISESVRLIDLGSDEVATAGKTMSTIVDAVASVTHIMQEIAAASDEQSRGITQ VSQAISEMDKVTQQNASLVEEASAAAVSLEEQAARLTEAVDVFRLHKHSVSAEPRGAGEP VSFATV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | trg |
Synonyms | trg; b1421; JW1417; Methyl-accepting chemotaxis protein III; MCP-III; Ribose and galactose chemoreceptor protein |
UniProt ID | P05704 |
◆ Recombinant Proteins | ||
RNF181-7149H | Recombinant Human Ring Finger Protein 181, His-tagged | +Inquiry |
TAS2R113-5601R | Recombinant Rat TAS2R113 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRMT2A-10296Z | Recombinant Zebrafish TRMT2A | +Inquiry |
DSTN-7076C | Recombinant Chicken DSTN | +Inquiry |
DEFB1-11929H | Recombinant Human DEFB1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-08R | Native Rat Collagen Type I and III Protein | +Inquiry |
Gliadin-168W | Native Wheat Gliadin | +Inquiry |
Lectin-1757C | Active Native Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
IgG-327H | Native HORSE IgG whole molecule | +Inquiry |
Laminin-32H | Native Human Laminin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF221-118HCL | Recombinant Human ZNF221 293 Cell Lysate | +Inquiry |
EPHB6-1319CCL | Recombinant Cynomolgus EPHB6 cell lysate | +Inquiry |
CPBTT30931GH | Goat Anti-Human Hemoglobin PAb | +Inquiry |
MRPL47-4162HCL | Recombinant Human MRPL47 293 Cell Lysate | +Inquiry |
RHBDL2-1503HCL | Recombinant Human RHBDL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All trg Products
Required fields are marked with *
My Review for All trg Products
Required fields are marked with *
0
Inquiry Basket