Recombinant Full Length Escherichia Coli Inner Membrane Transport Permease Ybhs(Ybhs) Protein, His-Tagged
Cat.No. : | RFL2758EF |
Product Overview : | Recombinant Full Length Escherichia coli Inner membrane transport permease ybhS(ybhS) Protein (P0AFQ2) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MSNPILSWRRVRALCVKETRQIVRDPSSWLIAVVIPLLLLFIFGYGINLDSSKLRVGILL EQRSEAALDFTHTMTGSPYIDATISDNRQELIAKMQAGKIRGLVVIPVDFAEQMERANAT APIQVITDGSEPNTANFVQGYVEGIWQIWQMQRAEDNGQTFEPLIDVQTRYWFNPAAISQ HFIIPGAVTIIMTVIGAILTSLVVAREWERGTMEALLSTEITRTELLLCKLIPYYFLGML AMLLCMLVSVFILGVPYRGSLLILFFISSLFLLSTLGMGLLISTITRNQFNAAQVALNAA FLPSIMLSGFIFQIDSMPAVIRAVTYIIPARYFVSTLQSLFLAGNIPVVLVVNVLFLIAS AVMFIGLTWLKTKRRLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybhS |
Synonyms | ybhS; b0793; JW0777; Probable multidrug ABC transporter permease YbhS |
UniProt ID | P0AFQ2 |
◆ Recombinant Proteins | ||
BEX6-2386M | Recombinant Mouse BEX6 Protein | +Inquiry |
MSI1-317HF | Recombinant Full Length Human MSI1 Protein | +Inquiry |
BCL9-527R | Recombinant Rhesus monkey BCL9 Protein, His-tagged | +Inquiry |
RFL21024HF | Recombinant Full Length Human Olfactory Receptor 3A2(Or3A2) Protein, His-Tagged | +Inquiry |
RFL22561BF | Recombinant Full Length Bovine Claudin-11(Cldn11) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PGI-31 | Active Native Phosphoglucose isomerase | +Inquiry |
CSN-36H | Native Human COP9 signalosome Protein | +Inquiry |
Peroxidase-32H | Active Native Horseradish Peroxidase | +Inquiry |
TF-31158TH | Native Human TF | +Inquiry |
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB1-2152MCL | Recombinant Mouse EFNB1 cell lysate | +Inquiry |
SELE-845MCL | Recombinant Mouse SELE cell lysate | +Inquiry |
SLCO1C1-1687HCL | Recombinant Human SLCO1C1 293 Cell Lysate | +Inquiry |
C8orf33-7953HCL | Recombinant Human C8orf33 293 Cell Lysate | +Inquiry |
CREB3L4-397HCL | Recombinant Human CREB3L4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ybhS Products
Required fields are marked with *
My Review for All ybhS Products
Required fields are marked with *
0
Inquiry Basket