Recombinant Full Length Escherichia Coli Inner Membrane Protein Ygjv(Ygjv) Protein, His-Tagged
Cat.No. : | RFL29212EF |
Product Overview : | Recombinant Full Length Escherichia coli Inner membrane protein ygjV(ygjV) Protein (P42603) (1-183aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-183) |
Form : | Lyophilized powder |
AA Sequence : | MTAYWLAQGVGVIAFLIGITTFFNRDERRFKKQLSVYSAVIGVHFFLLGTYPAGASAILN AIRTLITLRTRSLWVMAIFIVLTGGIGLAKFHHPVELLPVIGTIVSTWALFCCKGLTMRC VMWFSTCCWVIHNFWAGSIGGTMIEGSFLLMNGLNIIRFWRMQKRGIDPFKVEKTPSAVD ERG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ygjV |
Synonyms | ygjV; b3090; JW3061; Inner membrane protein YgjV |
UniProt ID | P42603 |
◆ Native Proteins | ||
Collagen Type IV-09H | Native Human Collagen Type IV | +Inquiry |
IgG-165R | Native Rabbit IgG Fc fragment | +Inquiry |
ung-8332E | Native E.coli ung | +Inquiry |
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
Type II Collagen-01C | Native Chicken Type II Collagen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTRB1-7194HCL | Recombinant Human CTRB1 293 Cell Lysate | +Inquiry |
MGAT4B-4341HCL | Recombinant Human MGAT4B 293 Cell Lysate | +Inquiry |
CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
FBXO42-6294HCL | Recombinant Human FBXO42 293 Cell Lysate | +Inquiry |
PRKCI-2854HCL | Recombinant Human PRKCI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ygjV Products
Required fields are marked with *
My Review for All ygjV Products
Required fields are marked with *
0
Inquiry Basket