Recombinant Full Length Acanthamoeba Castellanii Nadh-Ubiquinone Oxidoreductase Chain 6(Nd6) Protein, His-Tagged
Cat.No. : | RFL996AF |
Product Overview : | Recombinant Full Length Acanthamoeba castellanii NADH-ubiquinone oxidoreductase chain 6(ND6) Protein (Q37371) (1-260aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acanthamoeba castellanii (Amoeba) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-260) |
Form : | Lyophilized powder |
AA Sequence : | MLTNYLLIIFCFLALFCSFMIIASKNPIHSILYLILVFCNVTFVLIILGVEFIAIIFLIV YVGAIAVLFLFVVMMLNIKILELDEVFWRYIPAGLLISSCFLFQLFTFVFNFSVVEVFGL FFYNGFYSINKLALNFSEIHTVPSGLLINGIYIFPNLSNLGIDQVFINSIYKEESFFCFV KLNEASTNLLGLSFELTNTEILGWLVYTYTFFIFLVVSLILLISMIGSIILVLNQNINIK RQVIFRQSLRDLKSSVSLKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ND6 |
Synonyms | ND6; NAD6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6 |
UniProt ID | Q37371 |
◆ Native Proteins | ||
C4A-2H | Native Human Complement C4 | +Inquiry |
FABP-176P | Native Porcine Fatty acid Binding Protein | +Inquiry |
Collagen Type I-01B | Native Bovine Collagen Type I (Atelocollagen) Protein | +Inquiry |
MUC19-185B | Native Bovine Mucin Protein | +Inquiry |
HDL-1539H | Native Human High-density lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Prostate -157H | Human Fetal Prostate Lysate | +Inquiry |
RPL10A-2229HCL | Recombinant Human RPL10A 293 Cell Lysate | +Inquiry |
FOXJ2-6154HCL | Recombinant Human FOXJ2 293 Cell Lysate | +Inquiry |
HK3-550HCL | Recombinant Human HK3 cell lysate | +Inquiry |
CCNE1-666HCL | Recombinant Human CCNE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ND6 Products
Required fields are marked with *
My Review for All ND6 Products
Required fields are marked with *
0
Inquiry Basket