Recombinant Full Length Escherichia Coli Inner Membrane Protein Ybhq(Ybhq) Protein, His-Tagged
Cat.No. : | RFL20729EF |
Product Overview : | Recombinant Full Length Escherichia coli Inner membrane protein ybhQ(ybhQ) Protein (P0AAW5) (1-136aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-136) |
Form : | Lyophilized powder |
AA Sequence : | MKWQQRVRVATGLSCWQIMLHLLVVALLVVGWMSKTLVHVGVGLCALYCVTVVMMLVFQR HPEQRWREVADVLEELTTTWYFGAALIVLWLLSRVLENNFLLAIAGLAILAGPAVVSLLA KDKKLHHLTSKHRVRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybhQ |
Synonyms | ybhQ; b0791; JW0774; Inner membrane protein YbhQ |
UniProt ID | P0AAW5 |
◆ Native Proteins | ||
Amylase-64H | Active Native Human Amylase, alpha | +Inquiry |
ALB-524H | Native Human ALB protein | +Inquiry |
RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT1-680HCL | Recombinant Human GALNT1 cell lysate | +Inquiry |
ZNF544-2047HCL | Recombinant Human ZNF544 cell lysate | +Inquiry |
POR-3006HCL | Recombinant Human POR 293 Cell Lysate | +Inquiry |
MOLT-4-022HCL | Human MOLT-4 Cell Nuclear Extract | +Inquiry |
ZNF394-81HCL | Recombinant Human ZNF394 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ybhQ Products
Required fields are marked with *
My Review for All ybhQ Products
Required fields are marked with *
0
Inquiry Basket