Recombinant Full Length Escherichia Coli Colicin-B(Cba) Protein, His-Tagged
Cat.No. : | RFL36555EF |
Product Overview : | Recombinant Full Length Escherichia coli Colicin-B(cba) Protein (P05819) (2-511aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-511) |
Form : | Lyophilized powder |
AA Sequence : | SDNEGSVPTEGIDYGDTMVVWPSTGRIPGGDVKPGGSSGLAPSMPPGWGDYSPQGIALVQ SVLFPGIIRRIILDKELEEGDWSGWSVSVHSPWGNEKVSAARTVLENGLRGGLPEPSRPA AVSFARLEPASGNEQKIIRLMVTQQLEQVTDIPASQLPAAGNNVPVKYRLTDLMQNGTQY MAIIGGIPMTVPVVDAVPVPDRSRPGTNIKDVYSAPVSPNLPDLVLSVGQMNTPVRSNPE IQEDGVISETGNYVEAGYTMSSNNHDVIVRFPEGSGVSPLYISAVEILDSNSLSQRQEAE NNAKDDFRVKKEQENDEKTVLTKTSEVIISVGDKVGEYLGDKYKALSREIAENINNFQGK TIRSYDDAMSSINKLMANPSLKINATDKEAIVNAWKAFNAEDMGNKFAALGKTFKAADYA IKANNIREKSIEGYQTGNWGPLMLEVESWVISGMASAVALSLFSLTLGSALIAFGLSATV VGFVGVVIAGAIGAFIDDKFVDELNHKIIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cba |
Synonyms | cba; Colicin-B |
UniProt ID | P05819 |
◆ Recombinant Proteins | ||
GSTK1-527H | Recombinant Human GSTK1, MYC/DDK-Tagged | +Inquiry |
IRX4-782H | Recombinant Human IRX4 | +Inquiry |
MB-532C | Recombinant Cynomolgus monkey MB protein, His-tagged | +Inquiry |
LRRC15-4633H | Recombinant Human LRRC15 protein, His-Avi-tagged, Biotinylated | +Inquiry |
Il21-175M | Recombinant Active Mouse IL21 Protein, His-tagged(C-ter) | +Inquiry |
◆ Native Proteins | ||
RNASE3-5318H | Native Human Ribonuclease, RNase A Family, 3 | +Inquiry |
ALB-8301S | Native Sheep ALB | +Inquiry |
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
BL-001C | Native Cynomolgus Brain Total Protein Lysates | +Inquiry |
SAA-152H | Native Human Serum Amyloid A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL22-83HCL | Recombinant Human METTL22 lysate | +Inquiry |
RAB3IP-2596HCL | Recombinant Human RAB3IP 293 Cell Lysate | +Inquiry |
RWDD2B-2102HCL | Recombinant Human RWDD2B 293 Cell Lysate | +Inquiry |
CDCP1-1313HCL | Recombinant Human CDCP1 cell lysate | +Inquiry |
CMBL-7421HCL | Recombinant Human CMBL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cba Products
Required fields are marked with *
My Review for All cba Products
Required fields are marked with *
0
Inquiry Basket