Recombinant Full Length Erwinia Tasmaniensis Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL21813EF |
Product Overview : | Recombinant Full Length Erwinia tasmaniensis Bifunctional protein aas(aas) Protein (B2VFS7) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Erwinia tasmaniensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MVLTFLRALLRLAFRTRLTGDLASLNKRRVLITPNHMSFLDGILLAVFLPVKPVFAVYSS ISSQWYMRALRSLIDFVPLDPTKPMSVKHLVKLIGQGRPVVIFPEGRITVTGSLMKIYDG AGFVAAKSQATVVPLRIEGAEYTPFGRLGGVVKRRLFPRITLTVLPATTIPMPQAPRARD RRRLAGEHLHHIMMEARMAVRPRETLYQAFLAARTRYGLFKPCIEDVNFKPDSYSGLLKK SLGVGRILERYSQPGEYVGLLLPNATVTAAAILGASMRGRVPAMLNYTAGVKGLTSALTA GEIKTVFTSRQFLDKGKLWHLPQGITQVKWIYLEDLKDTLTTQDKLWILGHLLLPRRAMV AQQPEDAAMVLFTSGSEGHPKGVVHSHKSLLANVEQIRTVADFTPCDRFMSALPLFHAFG LTVGLFTPLMTGARVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFAR LRYVVAGAEKLQDHTRELWMEKYGIRILEGYGVTECAPVVAINVPMAAKSHTVGRILPGM DSRLVSVPGIEQGGRLQLRGPNIMKGYLRVEHPGRLEAPQADNGEGQMEPGWYDTGDIVS FDEGGFCQIQGRVKRFAKIAGEMVSLEIVEQIARNASDDKQHAATIKPDGNRGEALVLFT TDAQLTREQLMHSARELGSPELAVPRDIRLLSQLPLLGSGKPDFVTLREMAEQPEDRRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; ETA_27680; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Lon |
UniProt ID | B2VFS7 |
◆ Recombinant Proteins | ||
S-411S | Recombinant SARS-CoV-2 Spike S1 ((157-158) deletion, T19R, G142D, E156G, L452R, T478K, D614G, P681R) Protein, His/AVI-tagged, Biotinylated | +Inquiry |
CYP27C1-6281Z | Recombinant Zebrafish CYP27C1 | +Inquiry |
CSF2-03H | Active Recombinant Human CSF2 protein | +Inquiry |
PYCR2-4857R | Recombinant Rat PYCR2 Protein | +Inquiry |
CD27-1418HFL | Recombinant Full Length Human CD27 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
REN-245H | Active Native Human Renin | +Inquiry |
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
Ferritin-027H | Native Human Ferritin Protein, apo form | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPFIBP1-2979HCL | Recombinant Human PPFIBP1 293 Cell Lysate | +Inquiry |
HOP92-049WCY | Human Non-small Cell Lung Adenocarcinoma HOP92 Whole Cell Lysate | +Inquiry |
KHDRBS3-4986HCL | Recombinant Human KHDRBS3 293 Cell Lysate | +Inquiry |
SNX7-1664HCL | Recombinant Human SNX7 cell lysate | +Inquiry |
F12-2115HCL | Recombinant Human F12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket