Recombinant Full Length Epstein-Barr Virus Protein Bdlf2 (Bdlf2) Protein, His-Tagged
Cat.No. : | RFL6193EF |
Product Overview : | Recombinant Full Length Epstein-Barr virus Protein BDLF2 (BDLF2) Protein (P0C742) (1-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HHV4 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-420) |
Form : | Lyophilized powder |
AA Sequence : | MVDEQVAVEHGTVSHTISREEDGVVHERRVLASGERVEVFYKAPAPRPREGRASTFHDFT VPAAAAVPGPEPEPEPHPPMPIHANGGGETKTNTQDQNQNQTTRTRTNAKAEERTAEMDD TMASSGGQRGAPISADLLSLSSLTGRMAAMAPSWMKSEVCGERMRFKEDVYDGEAETLAE PPRCFMLSFVFIYYCCYLAFLALLAFGFNPLFLPSFMPVGAKVLRGKGRDFGVPLSYGCP TNPFCKVYTLIPAVVINNVTYYPNNTDSHGGHGGFEAAALHVAALFESGCPNLQAVTNRN RTFNVTRASGRVERRLVQDMQRVLASAVVVMHHHCHYETYYVFDGVGPEFGTIPTPCFKD VLAFRPSLVTNCTAPLKTSVKGPNWSGAAGGMKRKQCRVDRLTDRSFPAYLEEVMYVMVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BDLF2 |
Synonyms | BDLF2; Protein BDLF2 |
UniProt ID | P0C742 |
◆ Native Proteins | ||
TTR-131H | Native Human Prealbumin protein | +Inquiry |
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
ALB-37G | Native Goat Albumin (ALB) Protein | +Inquiry |
MUC16-1H | Native Human MUC16 protein | +Inquiry |
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
◆ Cell & Tissue Lysates | ||
APITD1-8794HCL | Recombinant Human APITD1 293 Cell Lysate | +Inquiry |
RET-1822HCL | Recombinant Human RET cell lysate | +Inquiry |
CFB-7558HCL | Recombinant Human CFB 293 Cell Lysate | +Inquiry |
KHK-4985HCL | Recombinant Human KHK 293 Cell Lysate | +Inquiry |
FAM134C-6425HCL | Recombinant Human FAM134C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDLF2 Products
Required fields are marked with *
My Review for All BDLF2 Products
Required fields are marked with *
0
Inquiry Basket