Recombinant Full Length Buchnera Aphidicola Subsp. Acyrthosiphon Pisum Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged

• Cat.No.: RFL7071BF
• Product Overview: Recombinant Full Length Buchnera aphidicola subsp. Acyrthosiphon pisum Electron transport complex protein RnfA(rnfA) Protein (B8D8R4) (1-193aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Buchnera aphidicola subsp. Acyrthosiphon pisum
• Source: E.coli
• Tag: His
• ProteinLength: Full Length (1-193)
• Form: Lyophilized powder
• AA Sequence: MKHYILFFISNILIENFILVKFLGLCPFLGASSNIETAFGMSCATTFVILTSSVLLWCVN FFILLPLDLIYLRIIAYMLIVSVSVQFLEIVLRKTSPILYRLLGIFLPLITTNCTVLAIP LFSLYEHHTFLESIFYGLSASLGFALVMIIFSCIRERIVLSDIPLPFQGAPIILITVSLI SITFMGFKGLIKI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: rnfA
• Synonyms: rnfA; BUAP5A_111; Ion-translocating oxidoreductase complex subunit A; Rnf electron transport complex subunit A
• UniProt ID: B8D8R4