Recombinant Full Length Enterococcus Phage Phief24C Putative Major Capsid Protein Protein, His-Tagged
Cat.No. : | RFL20039EF |
Product Overview : | Recombinant Full Length Enterococcus phage phiEF24C Putative major capsid protein Protein (P85226) (21-464aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterococcus phage phiEF24C (Enterococcus bacteriophage phi-EF24C) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-464) |
Form : | Lyophilized powder |
AA Sequence : | GFTTGYGITPESQTDAAALRREFLDDQITMLTWADGDLSFYRDITKRPATSTVAKYDVYL AHGRVGHTRFTREIGVAPISDPNLRQKTVNMKYVSDTKNMSIATGLVNNIEDPMRILTDD AISVVAKTIEWASFYGDSDLSENPDAGSGLEFDGLAKLIDKHNVLDAKGASLTEALLNQA SVLVGKGYGTPTDAYMPIGVQADFVNQQLDRQVQVISDNGQNATMGFNVKGFNSARGFIR LHGSTVMELEQILDENRMQLPNAPQKATVKATLEAGTKGKFRDEDLTIDTEYKVVVVSDD AESAPSDVASVVIDDKKKQVKLEITINNMYQARPQYVAIYRKGLETGLFYQIARVPASKA VEGVITFIDVNDEIPETADVFVGELTPSVVHLFELLPMMRLPLAQVNASVTFAVLWYGAL ALRAPKKWARIKNVKYIATGNVFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Enterococcus phage phiEF24C Putative major capsid protein |
Synonyms | Putative major capsid protein |
UniProt ID | P85226 |
◆ Native Proteins | ||
CAPN1-27397TH | Active Native Human Calpain-1 | +Inquiry |
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
GPT-189P | Active Native Porcine Glutamate Pyruvate Transaminase (GPT), Alanine Transaminase (ALT) | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
ALB-03C | Native Cynomolgus Monkey ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELK1-520HCL | Recombinant Human ELK1 cell lysate | +Inquiry |
MYO3A-1160HCL | Recombinant Human MYO3A cell lysate | +Inquiry |
KDM3A-4997HCL | Recombinant Human KDM3A 293 Cell Lysate | +Inquiry |
SH2D1A-1879HCL | Recombinant Human SH2D1A 293 Cell Lysate | +Inquiry |
METTL9-4354HCL | Recombinant Human METTL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Enterococcus phage phiEF24C Putative major capsid protein Products
Required fields are marked with *
My Review for All Enterococcus phage phiEF24C Putative major capsid protein Products
Required fields are marked with *
0
Inquiry Basket