Recombinant Full Length Agrostis Stolonifera Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL12213AF |
Product Overview : | Recombinant Full Length Agrostis stolonifera Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (A1E9Z4) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrostis stolonifera |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTFVLAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVLDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGLGAFLLVLKALYFGGVYDTWAPGGG DVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGFICVFGGIWHILT KPFAWARRAFVWSGEAYLSYSLAALSVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDLEPVLYMNPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | A1E9Z4 |
◆ Recombinant Proteins | ||
KINB-1253B | Recombinant Bacillus subtilis KINB protein, His-tagged | +Inquiry |
RFL29284SF | Recombinant Full Length Streptococcus Gordonii Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
FAM78AB-6422Z | Recombinant Zebrafish FAM78AB | +Inquiry |
FGF22-32H | Active Recombinant Human FGF22 protein, His-tagged | +Inquiry |
CYR61-5179Z | Recombinant Zebrafish CYR61 | +Inquiry |
◆ Native Proteins | ||
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
C3-001C | Active Native C. botulinum C3 Enzyme | +Inquiry |
AMY2-5364P | Native Pig Amylase, Alpha 2B (pancreatic) | +Inquiry |
IgG-327H | Native HORSE IgG whole molecule | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A2-2860HCL | Recombinant Human S100A2 cell lysate | +Inquiry |
FAM158A-6419HCL | Recombinant Human FAM158A 293 Cell Lysate | +Inquiry |
EDA2R-990CCL | Recombinant Cynomolgus EDA2R cell lysate | +Inquiry |
PCDH10-1293HCL | Recombinant Human PCDH10 cell lysate | +Inquiry |
RARA-2516HCL | Recombinant Human RARA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket