Recombinant Full Length Koribacter Versatilis Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL15699KF |
Product Overview : | Recombinant Full Length Koribacter versatilis Protein translocase subunit SecD(secD) Protein (Q1IVE9) (1-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Koribacter versatilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-535) |
Form : | Lyophilized powder |
AA Sequence : | MKKNLTWKVVVIVAVLLVFAFGIIGNPAEVKWDKEGLKTALMNRIHLGLDLRGGTHLILQ VVVNDAVNAETDRAIERIKEDLANNKVTYSDITKPDAANAPERIAIKGITPDGATTLRRV SDERLPEYSFGSGPEGSYTLTMKPAQLKDLKDRAVQQAIQKIRERVDSLGVSEPVIQEHG LGDYQILVQLPGVDDPARVKEVMQSTAMLEIRQVFGGPYSKESEAAQGQMQQPDTVVLPG KSESDPGTQVFYLVARSSAVAGHDLRQARVGRDQNGGANVQFNLTRDGGVRFSQFTSAHV GDKLGVILDGKVMEVANIKSEISDSGEIEGRFTDQQASDLALILNSGALPASIKYLEERT VGPSLGMDSIRQGVRAAIIGFVAVIIFMLIYYKGAGINADLSLLLNLVILLGFMGYFGAV LTLPGIAGVILTVGMGVDSNVLIFERIREELRNGKTPPSAVEQGFGHAWLTIIDTHVTTI VSAIILFLFGTGPVKGFAVTLSFGLFANLFTAVFVSRVIFDSILNRHQRGEALSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; Acid345_0146; Protein translocase subunit SecD |
UniProt ID | Q1IVE9 |
◆ Recombinant Proteins | ||
Prap1-5096M | Recombinant Mouse Prap1 Protein, Myc/DDK-tagged | +Inquiry |
cyp1a1-5321R | Recombinant Rainbow trout cyp1a1 protein, His&Myc-tagged | +Inquiry |
LRRTM2-9316M | Recombinant Mouse LRRTM2 Protein | +Inquiry |
PI3-5494H | Recombinant Human PI3 protein, His-tagged | +Inquiry |
Agr2-126M | Recombinant Mouse Agr2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ApoC-II-3558H | Native Human ApoC-II | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
C1R-96H | Active Native Human C1r Enzyme | +Inquiry |
RPE-135 | Native Red algae R-Phycoerythrin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RND3-2312HCL | Recombinant Human RND3 293 Cell Lysate | +Inquiry |
MRPS34-4136HCL | Recombinant Human MRPS34 293 Cell Lysate | +Inquiry |
RAB34-2605HCL | Recombinant Human RAB34 293 Cell Lysate | +Inquiry |
SEC11A-2002HCL | Recombinant Human SEC11A 293 Cell Lysate | +Inquiry |
C14orf169-206HCL | Recombinant Human C14orf169 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket