Recombinant Full Length Eastern Equine Encephalitis Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL33133EF |
Product Overview : | Recombinant Full Length Eastern equine encephalitis virus Structural polyprotein Protein (Q4QXJ7) (802-1242aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | EEEV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (802-1242) |
Form : | Lyophilized powder |
AA Sequence : | YEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTRIIPSTNLEYITCKYKTKVPSPVV KCCGATQCTSKPHPDYQCQVFTGVYPFMWGGAYCFCDTENTQMSEAYVERSEECSIDHAK AYKVHTGTVQAMVNITYGSVSWRSADVYVNGETPAKIGDAKLIIGPLSSAWSPFDNKVVV YGHEVYNYDFPEYGTGKAGSFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSG FERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSDL ECKITECTYASDFGGIATVAYKSSKAGNCPIHSPSGVAVIKENDVTLAESGSFTFHFSTA NIHPAFKLQVCTSAVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSA FIVLGLIATAVVALVLFFHRH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Eastern equine encephalitis virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | Q4QXJ7 |
◆ Recombinant Proteins | ||
HA-3297V | Recombinant Influenza A H1N1 (A/swine/Kansas/00246/2004) HA protein(Met1-Ser524), His-tagged | +Inquiry |
COG6-3710M | Recombinant Mouse COG6 Protein | +Inquiry |
TAS2R144-5962R | Recombinant Rat TAS2R144 Protein | +Inquiry |
CD300C-13M | Recombinant Mouse CD300C Chimera Protein, N-Fc-tagged | +Inquiry |
RFL22017SF | Recombinant Full Length Salmonella Choleraesuis Upf0208 Membrane Protein Yfbv(Yfbv) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
HB-40C | Native Cattle Hemoglobin (HB) Protein | +Inquiry |
Trypsin-51P | Active Native Porcine Trypsin | +Inquiry |
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
HINT2-5557HCL | Recombinant Human HINT2 293 Cell Lysate | +Inquiry |
ZNHIT2-2096HCL | Recombinant Human ZNHIT2 cell lysate | +Inquiry |
DKC1-6916HCL | Recombinant Human DKC1 293 Cell Lysate | +Inquiry |
GALC-679HCL | Recombinant Human GALC cell lysate | +Inquiry |
SEMA3B-1981HCL | Recombinant Human SEMA3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Eastern equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
My Review for All Eastern equine encephalitis virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket