Recombinant Full Length Drosophila Simulans Atp Synthase Subunit A(Mt:Atpase6) Protein, His-Tagged
Cat.No. : | RFL9280DF |
Product Overview : | Recombinant Full Length Drosophila simulans ATP synthase subunit a(mt:ATPase6) Protein (P50269) (1-224aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila simulans (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-224) |
Form : | Lyophilized powder |
AA Sequence : | MMTNLFSVFDPSAIFNLSLNWLSTFLGLLMIPSIYWLMPSRYNIVWNSILLTLHKEFKTL LGPSGHNGSTFIFISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWIN HTQHMFAHLVPQGTPAILMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLLGNTGP SMSYLLVTFLLTAQIALLVLESAVAMIQSYVFAVLSTLYSSEVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mt:ATPase6 |
Synonyms | mt:ATPase6; ATP6; ATPase6; ATP synthase subunit a; F-ATPase protein 6 |
UniProt ID | P50269 |
◆ Recombinant Proteins | ||
Csf1-15R | Recombinant Rat Csf1 | +Inquiry |
HNRNPD-2815C | Recombinant Chicken HNRNPD | +Inquiry |
AIPL1-7743H | Recombinant Human AIPL1 protein, GST-tagged | +Inquiry |
KDM4D-2893R | Recombinant Rat KDM4D Protein, His (Fc)-Avi-tagged | +Inquiry |
TIMP3-412H | Recombinant Human TIMP3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C4-195H | Native Human Complement C4c | +Inquiry |
APOB-26875TH | Native Human APOB | +Inquiry |
THBS1-31515TH | Native Human THBS1 | +Inquiry |
CGB-8048H | Native Human Urine Beta Chorionic Gonadotropin (b-hCG) | +Inquiry |
Interferon alfa-P029H | Native Human interferon alpha therapeutic protein (Interferon alfa-n3) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF8-7HCL | Recombinant Human ZNF8 293 Cell Lysate | +Inquiry |
HT-1080-046HCL | Human HT-1080 Cell Nuclear Extract | +Inquiry |
PGBD3-3259HCL | Recombinant Human PGBD3 293 Cell Lysate | +Inquiry |
DDR2-1017CCL | Recombinant Cynomolgus DDR2 cell lysate | +Inquiry |
RUNX1T1-2109HCL | Recombinant Human RUNX1T1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mt:ATPase6 Products
Required fields are marked with *
My Review for All mt:ATPase6 Products
Required fields are marked with *
0
Inquiry Basket