Recombinant Full Length Drosophila Mojavensis Adenosine Monophosphate-Protein Transferase Ficd Homolog (Gi11595) Protein, His-Tagged
Cat.No. : | RFL10792DF |
Product Overview : | Recombinant Full Length Drosophila mojavensis Adenosine monophosphate-protein transferase FICD homolog (GI11595) Protein (B4KFW6) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila mojavensis (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MAMATGKATEEEQPEQGQQQQQLQQQQKQTTLQSTYRFALFFIAGCLAAFGFHALTSSSG SLLGWRLRLHHLPTAHYLQTRDEFAVYSVDELNAFKEFYDKSVSDSVGASLSEAEETNIK EAMGALRLAQEMYMTGKDDKAARLFEHALALAPKHPEVLLRYGEFLEHNQRNIVLADQYY FQALSINPSNTEALANRQRTADVVQLLDERRLSSLDEKRDALSAIHEANSALRRAKKEAY FQHIYHSVGIEGNTMTLAQTRSVLETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKLY ITLKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHIPPGPGDLAILMQRFEHWLNSEQSN SLHPVNYAALAHYKLVHIHPFVDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSQYYHFLK LANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESDGNVLAQLQSHTSSPE LYESGSGSGAGAGAGSGQKGMP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GI11595 |
Synonyms | GI11595; Protein adenylyltransferase Fic; De-AMPylase Fic |
UniProt ID | B4KFW6 |
◆ Recombinant Proteins | ||
CHIR-B2-3935C | Recombinant Chicken CHIR-B2 | +Inquiry |
RFX3-1021H | Recombinant Human RFX3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL31178SF | Recombinant Full Length Pig C-X-C Chemokine Receptor Type 4(Cxcr4) Protein, His-Tagged | +Inquiry |
KAT5-565HFL | Recombinant Full Length Human KAT5 Protein, C-Flag-tagged | +Inquiry |
3CLpro-1480S | Recombinant SARS-COV-2 3CLpro protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
GOx-30A | Active Native Aspergillus Niger Glucose Oxidase | +Inquiry |
DEF-196H | Native Human Defensins | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP4-1063HCL | Recombinant Human TIMP4 293 Cell Lysate | +Inquiry |
ESYT1-6535HCL | Recombinant Human ESYT1 293 Cell Lysate | +Inquiry |
CCDC117-7786HCL | Recombinant Human CCDC117 293 Cell Lysate | +Inquiry |
HSD17B3-5374HCL | Recombinant Human HSD17B3 293 Cell Lysate | +Inquiry |
EBPL-6732HCL | Recombinant Human EBPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GI11595 Products
Required fields are marked with *
My Review for All GI11595 Products
Required fields are marked with *
0
Inquiry Basket