Recombinant Full Length Drosophila Melanogaster Transmembrane Protein 43 Homolog(Cg8111) Protein, His-Tagged
Cat.No. : | RFL28037DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Transmembrane protein 43 homolog(CG8111) Protein (Q9VSB9) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MASLSETLRSHWPIALFGVILFVAGGTELYWNEGRAVHNMMALDEAHADIYSVRFTEEEQ EVGLEGRIVHLSGPILVGEPLTEPDYNIQLLAVKLRRRVQMYQWVEEAVEHNYGDSVGTT HSDSRTYYYTREWRDKIVDSRNFYNRHGHTNPSHFPIESHVQVADAVFIGRYELGAEVKE KFNNYQELTSDIRPEDSGVKLHLGIYYHTNDVFNPEVGDLRLLFSFAGMEGEVFSVVGKL SGNKLVPYITSRGVPVLLVYPGGLSVQEVFRLEARAQVLHTWWWRFVGWLLIFFGVTCNT KILRLLFVRVPLLVALAPDPQFPVTGNLLIAFSLALTIAAVAWILHRPVIGACLLLAGAS PYVWFTRNLVDYHRLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CG8111 |
Synonyms | CG8111; Transmembrane protein 43 homolog |
UniProt ID | Q9VSB9 |
◆ Recombinant Proteins | ||
EMR1-2850H | Recombinant Human EMR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NI36-RS05420-0791S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS05420 protein, His-tagged | +Inquiry |
GRB2-5038H | Recombinant Human GRB2 Protein, GST-tagged | +Inquiry |
MUC2-4626H | Recombinant Human MUC2 Protein (Ala4770-Ala5169), N-His tagged | +Inquiry |
GSTK1-4427H | Recombinant Human GSTK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX2-1594HCL | Recombinant Human SNX2 293 Cell Lysate | +Inquiry |
CHMP2A-7532HCL | Recombinant Human CHMP2A 293 Cell Lysate | +Inquiry |
NADSYN1-3985HCL | Recombinant Human NADSYN1 293 Cell Lysate | +Inquiry |
MEF2C-4375HCL | Recombinant Human MEF2C 293 Cell Lysate | +Inquiry |
ZIC4-164HCL | Recombinant Human ZIC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CG8111 Products
Required fields are marked with *
My Review for All CG8111 Products
Required fields are marked with *
0
Inquiry Basket