Recombinant Human GSTK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GSTK1-4427H
• Product Overview: GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_057001) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 25.5 kDa
• AA Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GSTK1 glutathione S-transferase kappa 1 [ Homo sapiens (human) ]
• Official Symbol: GSTK1
• Synonyms: GSTK1; glutathione S-transferase kappa 1; GST13; GST class-kappa; glutathione S-transferase k1; glutathione S-transferase subunit 13 homolog; GST; hGSTK1; GSTK1-1; GST13-13; GST 13-13
• Gene ID: 373156
• mRNA Refseq: NM_015917
• Protein Refseq: NP_057001
• MIM: 602321
• UniProt ID: Q9Y2Q3