Recombinant Full Length Drosophila Melanogaster Tachykinin-Like Peptides Receptor 99D(Takr99D) Protein, His-Tagged
Cat.No. : | RFL18250DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Tachykinin-like peptides receptor 99D(Takr99D) Protein (P30975) (1-519aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-519) |
Form : | Lyophilized powder |
AA Sequence : | MENRSDFEADDYGDISWSNWSNWSTPAGVLFSAMSSVLSASNHTPLPDFGQELALSTSSF NHSQTLSTDLPAVGDVEDAAEDAAASMETGSFAFVVPWWRQVLWSILFGGMVIVATGGNL IVVWIVMTTKRMRTVTNYFIVNLSIADAMVSSLNVTFNYYYMLDSDWPFGEFYCKLSQFI AMLSICASVFTLMAISIDRYVAIIRPLQPRMSKRCNLAIAAVIWLASTLISCPMMIIYRT EEVPVRGLSNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVGIELW GSKTIGECTPRQVENVRSKRRVVKMMIVVVLIFAICWLPFHSYFIITSCYPAITEAPFIQ ELYLAIYWLAMSNSMYNPIIYCWMNSRFRYGFKMVFRWCLFVRVGTEPFSRRENLTSRYS CSGSPDHNRIKRNDTQKSILYTCPSSPKSHRISHSGTGRSATLRNSLPAESLSSGGSGGG GHRKRLSYQQEMQQRWSGPNSATAVTNSSSTANTTQLLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TkR99D |
Synonyms | TkR99D; Takr99D; CG7887; Tachykinin-like peptides receptor 99D; Tachykinin-like receptor at 99D; dTKR |
UniProt ID | P30975 |
◆ Recombinant Proteins | ||
UBE3B-17739M | Recombinant Mouse UBE3B Protein | +Inquiry |
RFL25983BF | Recombinant Full Length Bacillus Weihenstephanensis Upf0754 Membrane Protein Bcerkbab4_0766 (Bcerkbab4_0766) Protein, His-Tagged | +Inquiry |
SELM-8000M | Recombinant Mouse SELM Protein, His (Fc)-Avi-tagged | +Inquiry |
SDHD-4952R | Recombinant Rat SDHD Protein, His (Fc)-Avi-tagged | +Inquiry |
DACH1-27091TH | Recombinant Human DACH1 | +Inquiry |
◆ Native Proteins | ||
Vtn-683R | Native Rat Vitronectin | +Inquiry |
PLAU -14H | Native Human HMW urokinase, fluorescein labeled | +Inquiry |
IgA-238R | Native Rabbit Immunoglobulin A | +Inquiry |
KRT19-5H | Native Human CK19 | +Inquiry |
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECE2-2976HCL | Recombinant Human ECE2 cell lysate | +Inquiry |
HMOX1-5467HCL | Recombinant Human HMOX1 293 Cell Lysate | +Inquiry |
SLC6A9-1702HCL | Recombinant Human SLC6A9 293 Cell Lysate | +Inquiry |
RNF185-1523HCL | Recombinant Human RNF185 cell lysate | +Inquiry |
KIR3DL1-935HCL | Recombinant Human KIR3DL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TkR99D Products
Required fields are marked with *
My Review for All TkR99D Products
Required fields are marked with *
0
Inquiry Basket