Recombinant Full Length Bacillus Weihenstephanensis Upf0754 Membrane Protein Bcerkbab4_0766 (Bcerkbab4_0766) Protein, His-Tagged
Cat.No. : | RFL25983BF |
Product Overview : | Recombinant Full Length Bacillus weihenstephanensis UPF0754 membrane protein BcerKBAB4_0766 (BcerKBAB4_0766) Protein (A9VGI0) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus weihenstephanensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MNIWLNMLITTGLGAIIGGYTNHLAIKMLFRPHRPIYIGKFQVPFTPGLIPKRRDELAVQ LGKMVVDHLLTPEGIGKKLTNKEFQTSLIRWTQVEVDKVITNEQSLRDMLEKWNLEHVEE EAIGKIEHVITEKIHAFLAEYYTYTWEQALPHSVHEKVENAIPNVASFILKRGISFLESE EGKERLSKMIDDFFASRGTLLNLVGMFLGNVSLVDRVQPEVIKFLGQDGTERLLTDVLQK EWEKLKGRDVKELETFVEKEMIVNSILSAVKVEETVSRFLNQSVQQVCEPVRETIVGKVV PSAVEKGLKWGTENVGSILGNLQLAEIVQQEVSTFSTERLEDLVLSITKNELKMITYLGA LLGGTIGFIQGLLLLFLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BcerKBAB4_0766 |
Synonyms | BcerKBAB4_0766; UPF0754 membrane protein BcerKBAB4_0766 |
UniProt ID | A9VGI0 |
◆ Recombinant Proteins | ||
PMF1-27991TH | Recombinant Human PMF1, His-tagged | +Inquiry |
CD22-8854CAF488 | Recombinant Monkey CD22 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
BDH1-621R | Recombinant Rat BDH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARG1-0629H | Recombinant Human ARG1 Protein (Met1-lys322), C-His-tagged | +Inquiry |
RFL27549SF | Recombinant Full Length Salmonella Choleraesuis Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HPX-206H | Native Human Native Human HPX | +Inquiry |
IGHG3-120H | Native Human Immunoglobulin G3 | +Inquiry |
Laminin-32H | Native Human Laminin protein | +Inquiry |
IBVV0400-231I | Native Influenza (B/Victoria/504/00) IBVV0400 protein | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPOP-1502HCL | Recombinant Human SPOP 293 Cell Lysate | +Inquiry |
SF1-1922HCL | Recombinant Human SF1 293 Cell Lysate | +Inquiry |
ARPIN-82HCL | Recombinant Human ARPIN lysate | +Inquiry |
OBFC2B-3610HCL | Recombinant Human OBFC2B 293 Cell Lysate | +Inquiry |
FIGF-2767HCL | Recombinant Human FIGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BcerKBAB4_0766 Products
Required fields are marked with *
My Review for All BcerKBAB4_0766 Products
Required fields are marked with *
0
Inquiry Basket