Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 83C(Or83C) Protein, His-Tagged
Cat.No. : | RFL12500DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 83c(Or83c) Protein (Q9VNK9) (1-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-397) |
Form : | Lyophilized powder |
AA Sequence : | MSTSESPSSRFRELSKYINSLTNLLGVDFLSPKLKFNYRTWTTIFAIANYTGFTVFTILN NGGDWRVGLKASLMTGGLFHGLGKFLTCLLKHQDMRRLVLYSQSIYDEYETRGDSYHRTL NSNIDRLLGIMKIIRNGYVFAFCLMELLPLAMLMYDGTRVTAMQYLIPGLPLENNYCYVV TYMIQTVTMLVQGVGFYSGDLFVFLGLTQILTFADMLQVKVKELNDALEQKAEYRALVRV GASIDGAENRQRLLLDVIRWHQLFTDYCRAINALYYELIATQVLSMALAMMLSFCINLSS FHMPSAIFFVVSAYSMSIYCILGTILEFAYDQVYESICNVTWYELSGEQRKLFGFLLRES QYPHNIQILGVMSLSVRTALQIVKLIYSVSMMMMNRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or83c |
Synonyms | Or83c; CG15581; Putative odorant receptor 83c |
UniProt ID | Q9VNK9 |
◆ Recombinant Proteins | ||
WNT3A-635HF | Recombinant Full Length Human WNT3A Protein, GST-tagged | +Inquiry |
CYB561D1-1311Z | Recombinant Zebrafish CYB561D1 | +Inquiry |
CYP125-1606M | Recombinant Mycobacterium Tuberculosis CYP125 Protein (1-433 aa), His-tagged | +Inquiry |
AMFR-12379Z | Recombinant Zebrafish AMFR | +Inquiry |
MSMB-3450R | Recombinant Rat MSMB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
Myh2-13R | Active Native Rabbit Myosin II Protein | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
CTRC-1209B | Native Bovine Chymotrypsin C (Caldecrin) | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP9L-6201HCL | Recombinant Human FKBP9L 293 Cell Lysate | +Inquiry |
MRAP-1131HCL | Recombinant Human MRAP cell lysate | +Inquiry |
PRKCQ-1416HCL | Recombinant Human PRKCQ cell lysate | +Inquiry |
ARMC1-8703HCL | Recombinant Human ARMC1 293 Cell Lysate | +Inquiry |
LRRFIP1-4620HCL | Recombinant Human LRRFIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or83c Products
Required fields are marked with *
My Review for All Or83c Products
Required fields are marked with *
0
Inquiry Basket