Recombinant Mycobacterium Tuberculosis CYP125 Protein (1-433 aa), His-tagged

• Cat.No.: CYP125-1606M
• Product Overview: Recombinant Mycobacterium Tuberculosis (strain ATCC 25618/H37Rv) CYP125 Protein (1-433 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Mycobacterium Tuberculosis
• Source: Yeast
• Tag: His
• Protein Length: 1-433 aa
• Description: Catalyzes the C-27 hydroxylation of cholest-4-en-3-one and cholesterol and subsequently oxidizes the alcohol of the former to the cholest-4-en-3-one-27-oic acid via the aldehyde intermediate. Not required to incorporate the cholesterol side-chain carbon atoms into cellular lipids.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 50.4 kDa
• AA Sequence: MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: cyp125 steroid C26-monooxygenase [ Mycobacterium tuberculosis H37Rv ]
• Official Symbol: CYP125
• Synonyms: cyp125; Cholest-4-en-3-one 26-monooxygenase; Cytochrome P450 125Steroid C27-monooxygenase
• Gene ID: 887782
• Protein Refseq: NP_218062
• UniProt ID: P9WPP1