Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 98C(Gr98C) Protein, His-Tagged
Cat.No. : | RFL16097DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 98c(Gr98c) Protein (Q8IMN6) (1-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-408) |
Form : | Lyophilized powder |
AA Sequence : | MEMEAKRSRLLTTARPYLQVLSLFGLTPPAEFFTRTLRKRRRFCWMAGYSLYLIAILLMV FYEFHANIVSLHLEIYKFHVEDFSKVMGRTQKFLIVAIATCNQLNILLNYGRLGLIYDEI ANLDLGIDKSSKNFCGKSHWWSFRLRLTLSIGLWMVIIIGVIPRLTLGRAGPFFHWVNQV LTQIILIMLQLKGPEYCLFVLLVYELILRTRHVLEQLKDDLEDFDCGARIQELCVTLKQN QLLIGRIWRLVDEIGAYFRWSMTLLFLYNGLTILHVVNWAIIRSIDPNDCCQLNRLGSIT FLSFNLLLTCFFSECCVKTYNSISYILHQIGCLPTAEEFQMLKMGLKEYILQMQHLKLLF TCGGLFDINIKLFGGMLVTLCGYVIIIVQFKIQDFALIGYRQNTSDTS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr98c |
Synonyms | Gr98c; GR98B.3; CG31060; Putative gustatory receptor 98c |
UniProt ID | Q8IMN6 |
◆ Recombinant Proteins | ||
Mapk14-1762R | Recombinant Rat Mapk14 Protein, His-tagged | +Inquiry |
B4GALT4-580R | Recombinant Rat B4GALT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6V0D2-887R | Recombinant Rat ATP6V0D2 Protein | +Inquiry |
RFL7971PF | Recombinant Full Length Pyrococcus Horikoshii Upf0252 Protein Ph0672 (Ph0672) Protein, His-Tagged | +Inquiry |
ERBB4-217RAF555 | Recombinant Rat Erbb4 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Native Proteins | ||
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
IGF2-29116TH | Native Human IGF2 | +Inquiry |
Lectin-1861W | Active Native Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1E & B2M-001CCL | Recombinant Cynomolgus CD1E & B2M cell lysate | +Inquiry |
SNX19-1661HCL | Recombinant Human SNX19 cell lysate | +Inquiry |
GPR3-745HCL | Recombinant Human GPR3 cell lysate | +Inquiry |
LRRC31-4636HCL | Recombinant Human LRRC31 293 Cell Lysate | +Inquiry |
Skeletal Muscle-428H | Hamster Skeletal Muscle Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gr98c Products
Required fields are marked with *
My Review for All Gr98c Products
Required fields are marked with *
0
Inquiry Basket