Recombinant Full Length Pyrococcus Horikoshii Upf0252 Protein Ph0672 (Ph0672) Protein, His-Tagged
Cat.No. : | RFL7971PF |
Product Overview : | Recombinant Full Length Pyrococcus horikoshii UPF0252 protein PH0672 (PH0672) Protein (O58405) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pyrococcus Horikoshii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MKKVSVIIFIVIMLGIGCLNLNESIKETCPRTSNITQAMSCYIPEDFEILKGVAEEIPGG TIEWKIWNILEWEEDHLSYDNNKGSDIILKPSEFIKVGEGVCTDYAVLTAGLLLASNISP VYLMIFHFMEDPTLHAAVAVNISGKLFILDQRLPPKNLDSYLIQFSKLEGKIILFAEMYK VEMKKGRVVVSGRKYLDLSNFGFYPGNISLDMLENLLLSEFQRRTNLFPRIDLKTVLPQG LKERKVWMIKFENFKLFYDDTFVEQYSNFIADEILKNEKIKSDISRYSAFWISIKLEGDD LIVRLFLGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PH0672 |
Synonyms | PH0672; UPF0252 protein PH0672 |
UniProt ID | O58405 |
◆ Recombinant Proteins | ||
RFL18897XF | Recombinant Full Length Xanthomonas Axonopodis Pv. Citri Protease Htpx(Htpx) Protein, His-Tagged | +Inquiry |
TNFRSF1A-1497C | Recombinant Cynomolgus TNFRSF1A protein, His-tagged | +Inquiry |
H7N9-18I | Recombinant Influenza A virus H7N9 NA, His-tagged | +Inquiry |
FXC1-4574H | Recombinant Human FXC1 Protein, GST-tagged | +Inquiry |
SECE-942S | Recombinant Streptomyces coelicolor A3(2) SECE protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen type I-01H | Native Human Collagen type I Protein | +Inquiry |
ACTA1-157R | Native Rabbit skeletal muscle alpha Actin | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
C8-103H | Native Human C8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL25-1261RCL | Recombinant Rat IL25 cell lysate | +Inquiry |
BoneMarrow-506D | Dog Bone Marrow Lysate, Total Protein | +Inquiry |
TNFRSF10B-2397MCL | Recombinant Mouse TNFRSF10B cell lysate | +Inquiry |
C10ORF54-1249HCL | Recombinant Human C10ORF54 cell lysate | +Inquiry |
AP2S1-8811HCL | Recombinant Human AP2S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PH0672 Products
Required fields are marked with *
My Review for All PH0672 Products
Required fields are marked with *
0
Inquiry Basket