Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 97A(Gr97A) Protein, His-Tagged
Cat.No. : | RFL787DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 97a(Gr97a) Protein (Q8IMQ6) (1-423aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-423) |
Form : | Lyophilized powder |
AA Sequence : | MRFLRRQTRRLRSIWQRSLPVRFRRGKLHTQLVTICLYATVFLNILYGVYLGRFSFRRKK FVFSKGLTIYSLFVATFFALFYIWNIYNEISTGQINLRDTIGIYCYMNVCVCLFNYVTQW EKTLQIIRFQNSVPLFKVLDSLDISAMIVWRAFIYGLLKIVFCPLITYITLILYHRRSIS ESQWTSVTTTKTMLPLIVSNQINNCFFGGLVLANLIFAAVNRKLHGIVKEANMLQSPVQM NLHKPYYRMRRFCELADLLDELARKYGFTASRSKNYLRFTDWSMVLSMLMNLLGITMGCY NQYLAIADHYINEEPFDLFLAIVLVVFLAVPFLELVMVARISNQTLTRRTGELLQRFDLQ HADARFKQVVNAFWLQVVTINYKLMPLGLLELNTSLVNKVFSSAIGSLLILIQSDLTLRF SLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr97a |
Synonyms | Gr97a; GR97D.1; CG33083; Putative gustatory receptor 97a |
UniProt ID | Q8IMQ6 |
◆ Recombinant Proteins | ||
FAM3C-4333H | Recombinant Human FAM3C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PSMD14-2253H | Recombinant Full Length Human PSMD14 protein, MBP & His-tagged | +Inquiry |
EPN1-4628H | Recombinant Human EPN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CYP2U1-2270H | Recombinant Human CYP2U1 Protein, GST-tagged | +Inquiry |
FCER1A-237H | Recombinant Human FCER1A | +Inquiry |
◆ Native Proteins | ||
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
Actin-3084R | Active Native Rabbit Actin Protein | +Inquiry |
Immunoglobulin E-80H | Native Human Immunoglobulin E | +Inquiry |
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
USHBP1-727HCL | Recombinant Human USHBP1 lysate | +Inquiry |
IAPP-5319HCL | Recombinant Human IAPP 293 Cell Lysate | +Inquiry |
PIGK-3197HCL | Recombinant Human PIGK 293 Cell Lysate | +Inquiry |
MTF1-4085HCL | Recombinant Human MTF1 293 Cell Lysate | +Inquiry |
PDCD1-2873HCL | Recombinant Human PDCD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gr97a Products
Required fields are marked with *
My Review for All Gr97a Products
Required fields are marked with *
0
Inquiry Basket