Recombinant Full Length Human PSMD14 protein, MBP & His-tagged

• Cat.No.: PSMD14-2253H
• Product Overview: Recombinant Human PSMD14 protein(O00487)(1-310aa), fused to N-terminal MBP tag and C-terminal His tag, was expressed in Insect Cell.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His&MBP
• Protein Length: 1-310aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 79.2 kDa
• AA Sequence: MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: PSMD14 proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 [ Homo sapiens ]
• Official Symbol: PSMD14
• Synonyms: PSMD14; proteasome (prosome, macropain) 26S subunit, non-ATPase, 14; 26S proteasome non-ATPase regulatory subunit 14; pad1; POH1; Rpn11; 26S proteasome regulatory subunit rpn11; 26S proteasome-associated PAD1 homolog 1; PAD1; RPN11
• Gene ID: 10213
• mRNA Refseq: NM_005805
• Protein Refseq: NP_005796
• MIM: 607173
• UniProt ID: O00487