Recombinant Full Length Human PSMD14 protein, MBP & His-tagged
Cat.No. : | PSMD14-2253H |
Product Overview : | Recombinant Human PSMD14 protein(O00487)(1-310aa), fused to N-terminal MBP tag and C-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&MBP |
Protein Length : | 1-310aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 79.2 kDa |
AA Sequence : | MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PSMD14 proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 [ Homo sapiens ] |
Official Symbol | PSMD14 |
Synonyms | PSMD14; proteasome (prosome, macropain) 26S subunit, non-ATPase, 14; 26S proteasome non-ATPase regulatory subunit 14; pad1; POH1; Rpn11; 26S proteasome regulatory subunit rpn11; 26S proteasome-associated PAD1 homolog 1; PAD1; RPN11; |
Gene ID | 10213 |
mRNA Refseq | NM_005805 |
Protein Refseq | NP_005796 |
MIM | 607173 |
UniProt ID | O00487 |
◆ Recombinant Proteins | ||
PSMD14-6158H | Recombinant Human PSMD14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PSMD14-567C | Recombinant Cynomolgus Monkey PSMD14 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMD14-40H | Recombinant Human PSMD14 Protein, GST-tagged | +Inquiry |
PSMD14-6978H | Recombinant Full Length Human PSMD14 / PAD1, GST-tagged | +Inquiry |
PSMD14-3488R | Recombinant Rhesus Macaque PSMD14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMD14-2751HCL | Recombinant Human PSMD14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSMD14 Products
Required fields are marked with *
My Review for All PSMD14 Products
Required fields are marked with *
0
Inquiry Basket