Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 93A(Gr93A) Protein, His-Tagged
Cat.No. : | RFL15053DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 93a(Gr93a) Protein (Q9VD76) (1-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-419) |
Form : | Lyophilized powder |
AA Sequence : | MFSSSSAMTGKRAESWSRLLLLWLYRCARGLLVLSSSLDRDKLQLKATKQGSRNRFLHIL WRCIVVMIYAGLWPMLTSAVIGKRLESYADVLALAQSMSVSILAVISFVIQARGENQFRE VLNRYLALYQRICLTTRLRHLFPTKFVVFFLLKLFFTLCGCFHEIIPLFENSHFDDISQM VGTGFGIYMWLGTLCVLDACFLGFLVSGILYEHMANNIIAMLKRMEPIESQDERYRMTKY RRMQLLCDFADELDECAAIYSELYHVTNSFRRILQWQILFYIYLNFINICLMLYQYILHF LNDDEVVFVSIVMAFVKLANLVLLMMCADYTVRQSEVPKKLPLDIVCSDMDERWDKSVET FLGQLQTQRLEIKVLGFFHLNNEFILLILSAIISYLFILIQFGITGGFEASEDIKNRFD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr93a |
Synonyms | Gr93a; GR93F.1; CG13417; Gustatory receptor for bitter taste 93a |
UniProt ID | Q9VD76 |
◆ Native Proteins | ||
AsAGP-002B | Native Bovine Asialo-a1-acid glycoprotein Protein | +Inquiry |
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
Lectin-1808M | Active Native Maackia Amurensis Lectin I Protein, Fluorescein labeled | +Inquiry |
Lectin-1793A | Active Native Artocarpus integrifolia Jacalin Protein, Biotinylated | +Inquiry |
Fva-285B | Active Native Bovine Factor Va | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEMGN-5588HCL | Recombinant Human HEMGN 293 Cell Lysate | +Inquiry |
RNF175-2288HCL | Recombinant Human RNF175 293 Cell Lysate | +Inquiry |
ATL2-122HCL | Recombinant Human ATL2 cell lysate | +Inquiry |
CTSA-3026HCL | Recombinant Human CTSA cell lysate | +Inquiry |
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gr93a Products
Required fields are marked with *
My Review for All Gr93a Products
Required fields are marked with *
0
Inquiry Basket