Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 39A, Isoform B(Gr39A) Protein, His-Tagged
Cat.No. : | RFL33465DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 39a, isoform B(Gr39a) Protein (P58956) (1-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-372) |
Form : | Lyophilized powder |
AA Sequence : | MGTRNRKLLFFLHYQRYLGLTNLDFSKSLHIYWLHGTWSSTAIQIVVVGVFMAALLGALA ESLYYMETKSQTGNTFDNAVILTTSVTQLLANLWLRSQQKSQVNLLQRLSQVVELLQFEP YAVPQFRWLYRIWLLVCLIYGAMVTHFGINWLTTMQISRVLTLIGFVYRCVLANFQFTCY TGMVVILKKLLQVQVKQLEHLVSTTTISMAGVAGCLRTHDEILLLGQRELIAVYGGVILF LFIYQVMQCILIFYISNLEGFHSSNDLVLIFCWLAPMLFYLILPLVVNDIHNQANKTAKM LTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQFK EMENSTKSINKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr39a |
Synonyms | Gr39a; GR39D.2; CG31622; Gustatory and pheromone receptor 39a, isoform B |
UniProt ID | P58956 |
◆ Recombinant Proteins | ||
SNRPB-2061H | Recombinant Human SNRPB Protein, His (Fc)-Avi-tagged | +Inquiry |
TAS2R108-8998M | Recombinant Mouse TAS2R108 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTERFD1-6490HF | Recombinant Full Length Human MTERFD1 Protein, GST-tagged | +Inquiry |
TOP1-4899R | Recombinant Rhesus monkey TOP1 Protein, His-tagged | +Inquiry |
LRRC3B-652H | Recombinant Human LRRC3B Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
MG-41H | Active Native Human MG | +Inquiry |
IgG-159B | Native Bovine Immunoglobulin G | +Inquiry |
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
Fga-63R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX7-751HCL | Recombinant Human STX7 cell lysate | +Inquiry |
MS4A8B-1138HCL | Recombinant Human MS4A8B cell lysate | +Inquiry |
IL1RL1-001MCL | Recombinant Mouse IL1RL1 cell lysate | +Inquiry |
HA-1479HCL | Recombinant H10N9 HA cell lysate | +Inquiry |
NDUFA9-3914HCL | Recombinant Human NDUFA9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr39a Products
Required fields are marked with *
My Review for All Gr39a Products
Required fields are marked with *
0
Inquiry Basket