Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 28B(Gr28B) Protein, His-Tagged
Cat.No. : | RFL23002DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 28b(Gr28b) Protein (Q9VM08) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MDIEMAKEPVNPTDTPDIEVTPGLCQPLRRRFRRFVTAKQLYECLRPVFHVTYIHGLTSF YISCDTKTGKKAIKKTIFGYINGIMHIAMFVFAYSLTIYNNCESVASYFFRSRITYFGDL MQIVSGFIGVTVIYLTAFVPNHRLERCLQKFHTMDVQLQTVGVKIMYSKVLRFSYMVLIS MFLVNVLFTGGTFSVLYSSEVAPTMALHFTFLIQHTVIAIAIALFSCFTYLVEMRLVMVN KVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSMYTIVTKDPAEIIQESMEIHHLICEAAA TANKYFTYQLLTIISIAFLIIVFDAYYVLETLLGKSKRESKFKTVEFVTFFSCQMILYLI AIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFN IDRTLYFTISGALTTYLIILLQFTSNSPNNGYGNGSSCCETFNNMTNHTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr28b |
Synonyms | Gr28b; CG13788; Putative gustatory receptor 28b |
UniProt ID | Q9VM08 |
◆ Recombinant Proteins | ||
ZMYND19-1393H | Recombinant Human ZMYND19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
THIE-0191B | Recombinant Bacillus subtilis THIE protein, His-tagged | +Inquiry |
LENEP-8520Z | Recombinant Zebrafish LENEP | +Inquiry |
RFL21107DF | Recombinant Full Length Danio Rerio Oligosaccharyltransferase Complex Subunit Ostc(Ostc) Protein, His-Tagged | +Inquiry |
MATN4-631H | Recombinant Human MATN4 | +Inquiry |
◆ Native Proteins | ||
PMPCB-284H | Native Human PMPCB, DDK-tagged | +Inquiry |
ORM1-35H | Native Human Alpha 1 Acid Glycoprotein | +Inquiry |
WIM-5415B | Native Bovine Vimentin | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
dnt-142B | Active Native Bordetella bronchiseptica Dermonecrotic Toxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA13-3922HCL | Recombinant Human NDUFA13 293 Cell Lysate | +Inquiry |
UQCC2-7998HCL | Recombinant Human C6orf125 293 Cell Lysate | +Inquiry |
MRPL36-4175HCL | Recombinant Human MRPL36 293 Cell Lysate | +Inquiry |
ABLIM3-11HCL | Recombinant Human ABLIM3 cell lysate | +Inquiry |
INTS4-864HCL | Recombinant Human INTS4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr28b Products
Required fields are marked with *
My Review for All Gr28b Products
Required fields are marked with *
0
Inquiry Basket