Recombinant Human ZMYND19 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZMYND19-1393H |
Product Overview : | ZMYND19 MS Standard C13 and N15-labeled recombinant protein (NP_612471) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ZMYND19 is a MYND zinc finger domain-containing protein that binds to the C terminus of melanin-concentrating hormone receptor-1, and to the N termini of alpha-tubulin, and beta-tubulin. |
Molecular Mass : | 26.4 kDa |
AA Sequence : | MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPERTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZMYND19 zinc finger MYND-type containing 19 [ Homo sapiens (human) ] |
Official Symbol | ZMYND19 |
Synonyms | ZMYND19; zinc finger, MYND-type containing 19; zinc finger MYND domain-containing protein 19; MIZIP; MCH-R1-interacting zinc finger protein; zinc finger, MYND domain containing 19; melanin-concentrating hormone receptor 1 interacting zinc-finger protein; melanin-concentrating hormone receptor 1-interacting zinc finger protein; RP11-48C7.4; |
Gene ID | 116225 |
mRNA Refseq | NM_138462 |
Protein Refseq | NP_612471 |
MIM | 611424 |
UniProt ID | Q96E35 |
◆ Recombinant Proteins | ||
ZMYND19-338H | Recombinant Human ZMYND19 Protein, His-tagged | +Inquiry |
ZMYND19-6712R | Recombinant Rat ZMYND19 Protein | +Inquiry |
Zmynd19-7119M | Recombinant Mouse Zmynd19 Protein, Myc/DDK-tagged | +Inquiry |
ZMYND19-6013C | Recombinant Chicken ZMYND19 | +Inquiry |
ZMYND19-9692Z | Recombinant Zebrafish ZMYND19 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZMYND19-148HCL | Recombinant Human ZMYND19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZMYND19 Products
Required fields are marked with *
My Review for All ZMYND19 Products
Required fields are marked with *
0
Inquiry Basket