Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 22E(Gr22E) Protein, His-Tagged
Cat.No. : | RFL10909DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 22e(Gr22e) Protein (P58953) (1-389aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-389) |
Form : | Lyophilized powder |
AA Sequence : | MFRPSGSGYRQKWTGLTLKGALYGSWILGVFPFAYDSWTRTLRRSKWLIAYGFVLNAAFI LLVVTNDTESETPLRMEVFHRNALAEQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNE LEDLQHRYFRNYSLEECISFDRFVLYKGFSVVLELVSMLVLELGMSPNYSAQFFIGLGSL CLMLLAVLLGASHFHLAVVFVYRYVWIVNRELLKLVNKMAIGETVESERMDLLLYLYHRL LDLGQRLASIYDYQMVMVMVSFLIANVLGIYFFIIYSISLNKSLDFKILVFVQALVINML DFWLNVEICELAERTGRQTSTILKLFNDIENIDEKLERSITDFALFCSHRRLRFHHCGLF YVNYEMGFRMAITSFLYLLFLIQFDYWNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr22e |
Synonyms | Gr22e; CG31936; Gustatory receptor for bitter taste 22e |
UniProt ID | P58953 |
◆ Recombinant Proteins | ||
SKP1-11006Z | Recombinant Zebrafish SKP1 | +Inquiry |
CCDC151-2851M | Recombinant Mouse CCDC151 Protein | +Inquiry |
LRRC61-4647H | Recombinant Human LRRC61 Protein, GST-tagged | +Inquiry |
Gstm2-736R | Recombinant Rat Gstm2 protein, His-tagged | +Inquiry |
PHF1-12714M | Recombinant Mouse PHF1 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1735P | Active Native Peanut Agglutinin Protein, Rhodamine labeled | +Inquiry |
CA242-161H | Active Native Human Cancer Antigen 242 | +Inquiry |
LH-839H | Active Native Human Luteinizing Hormone | +Inquiry |
GC-29857TH | Native Human GC | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH5-2570MCL | Recombinant Mouse CDH5 cell lysate | +Inquiry |
MAD2L1BP-4569HCL | Recombinant Human MAD2L1BP 293 Cell Lysate | +Inquiry |
TUFM-1864HCL | Recombinant Human TUFM cell lysate | +Inquiry |
RPA2-2242HCL | Recombinant Human RPA2 293 Cell Lysate | +Inquiry |
ACVRL1-3093MCL | Recombinant Mouse ACVRL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr22e Products
Required fields are marked with *
My Review for All Gr22e Products
Required fields are marked with *
0
Inquiry Basket