Recombinant Full Length Drosophila Melanogaster Probable G-Protein Coupled Receptor Mth-Like 6(Mthl6) Protein, His-Tagged
Cat.No. : | RFL14163DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Probable G-protein coupled receptor Mth-like 6(mthl6) Protein (Q9VS77) (21-480aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-480) |
Form : | Lyophilized powder |
AA Sequence : | VIPGCDYFDTVDISHIPKLNDSYAYEELIIPAHLTGLYTFRQLADGSQEPVKSHLRACIC KLKPCIRFCCPRNKMMPNSRCSDGLTENLKRINPYLKITLEDGTIGKYYLLTDMIVLRYE FRYCEKVVSVQEDQYKLYENGSFMIKPDVNWTLSKQWYCLHPRLEDPNSIWILEHVYIPK SMPAVPQVGTISMVGCILTIAVYLYIKKLRNLLGKCFICYVFCKFVQYLIWAGGDLNLWN NICSLAGYTNYFFALASHFWLSVMSHQIWKNLRLINRDERSYHFLIYNIYGWGTPAIMTA ITYLVDWAWEDRPDKLNWIPGVGLYRCWINTYDWSAMIYLYGPMLILSLFNVVTFILTVN HIMKIKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVTGISEVITYFVKRHKFWRQVLRV PNFFHLGSGIVVFVLFILKRSTFQMIMERISGPRRQQPAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mthl6 |
Synonyms | mthl6; CG16992; Probable G-protein coupled receptor Mth-like 6; Protein methuselah-like 6 |
UniProt ID | Q9VS77 |
◆ Recombinant Proteins | ||
HDAC2-7529M | Recombinant Mouse HDAC2 Protein | +Inquiry |
CDKN2C-1377H | Recombinant Human Cyclin-Dependent Kinase Inhibitor 2C (p18, inhibits CDK4), His-tagged | +Inquiry |
GDF3-048H | Active Recombinant Human GDF3 Protein | +Inquiry |
DCP2-11861H | Recombinant Human DCP2 protein, His-tagged | +Inquiry |
VCP-3456C | Recombinant Chicken VCP | +Inquiry |
◆ Native Proteins | ||
IgG2-230H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
CRP-5330H | Native Canine CRP protein | +Inquiry |
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADPRHL2-9001HCL | Recombinant Human ADPRHL2 293 Cell Lysate | +Inquiry |
FAM151B-6422HCL | Recombinant Human FAM151B 293 Cell Lysate | +Inquiry |
ENOX1-6596HCL | Recombinant Human ENOX1 293 Cell Lysate | +Inquiry |
SIRP-BETA-1753MCL | Recombinant Mouse SIRP-BETA cell lysate | +Inquiry |
MGST1-1110HCL | Recombinant Human MGST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mthl6 Products
Required fields are marked with *
My Review for All mthl6 Products
Required fields are marked with *
0
Inquiry Basket