Recombinant Full Length Drosophila Melanogaster Probable G-Protein Coupled Receptor Mth-Like 3(Mthl3) Protein, His-Tagged
Cat.No. : | RFL12431DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Probable G-protein coupled receptor Mth-like 3(mthl3) Protein (Q9V818) (22-511aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-511) |
Form : | Lyophilized powder |
AA Sequence : | EIPGCDFFDTVDISKAPRFSNGSYLYEGLLIPAHLTAEYDYKLLADDSKEKVASHVRGCA CHLRPCIRFCCPQYQKMQKSKCYGDMSEDELNKHDPFVNVTLSDGSVVRRHFKEDLIVQS DLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWDKVELSKREYCVQHLSFKDDSIRIAP HFCPLSSEHSRTWKTVAIVISLICIILTISVYLYVEKLRNLHGKCFICYLASLFLGYFFL VLNVWKYSSGFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSY NLYAWGMALLLTAITYIADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVF NITMFVLTAFRIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISF LLSKNQAWAKAFMVADYFNWSQGTVIFLLFVLRPSTLKLLKERIKGGRDEAGASDEHISL QNTKIDPSVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mthl3 |
Synonyms | mthl3; BEST:GM02553; CG6530; Probable G-protein coupled receptor Mth-like 3; Protein methuselah-like 3 |
UniProt ID | Q9V818 |
◆ Recombinant Proteins | ||
RFL19064GF | Recombinant Full Length Geobacter Sp. Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
SOX2-2076H | Recombinant Human SOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCGR3A-901H | Recombinant Human FCGR3A Protein, His (Fc)-Avi-tagged | +Inquiry |
SYK-5859R | Recombinant Rat SYK Protein | +Inquiry |
CASP10-1125H | Recombinant Human CASP10 Protein (Phe223-Ile459), N-His tagged | +Inquiry |
◆ Native Proteins | ||
CRP-5299H | Native Human C-Reactive Protein, Pentraxin-Related | +Inquiry |
Chitosan-002C | Native Crawfish Chitosan | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
Lectin-1764C | Active Native Succinylated Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIT1-1839HCL | Recombinant Human TRIT1 cell lysate | +Inquiry |
ADAD1-9040HCL | Recombinant Human ADAD1 293 Cell Lysate | +Inquiry |
STX4-1375HCL | Recombinant Human STX4 293 Cell Lysate | +Inquiry |
PCDHB7-1300HCL | Recombinant Human PCDHB7 cell lysate | +Inquiry |
Atrium-226H | Human Heart: Atrium (RT) Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mthl3 Products
Required fields are marked with *
My Review for All mthl3 Products
Required fields are marked with *
0
Inquiry Basket