Recombinant Full Length Drosophila Melanogaster Opsin Rh4(Rh4) Protein, His-Tagged
Cat.No. : | RFL28866DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Opsin Rh4(Rh4) Protein (P08255) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MEPLCNASEPPLRPEARSSGNGDLQFLGWNVPPDQIQYIPEHWLTQLEPPASMHYMLGVF YIFLFCASTVGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCLKAPIFIYNSFHRGFA LGNTWCQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMNRNMTFTKAVIMNIIIWLYCT PWVVLPLTQFWDRFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCPTLMILYYYSQI VGHVFSHEKALREQAKKMNVESLRSNVDKSKETAEIRIAKAAITICFLFFVSWTPYGVMS LIGAFGDKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRLELQKRCPWLGVNEKSGE ISSAQSTTTQEQQQTTAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rh4 |
Synonyms | Rh4; CG9668; Opsin Rh4; Inner R7 photoreceptor cells opsin |
UniProt ID | P08255 |
◆ Recombinant Proteins | ||
TLR8-4737R | Recombinant Rhesus monkey TLR8 Protein, His-tagged | +Inquiry |
NR1I3-1278H | Recombinant Human Nuclear Receptor Subfamily 1, Group I, Member 3 | +Inquiry |
FCGR2A-297C | Active Recombinant Cynomolgus FCGR2A protein, His/Avi-tagged, Biotinylated | +Inquiry |
NDUFS2-10542M | Recombinant Mouse NDUFS2 Protein | +Inquiry |
PLA2G2A-522M | Recombinant Mouse PLA2G2A protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
Lectin-1730P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Rhodamine labeled | +Inquiry |
APOA2-608H | Native Human Apolipoprotein A-II | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAP1-1254HCL | Recombinant Human TAP1 293 Cell Lysate | +Inquiry |
LHX2-4751HCL | Recombinant Human LHX2 293 Cell Lysate | +Inquiry |
CD1d1-2446MCL | Recombinant Mouse CD1d1 cell lysate | +Inquiry |
FBXO44-6293HCL | Recombinant Human FBXO44 293 Cell Lysate | +Inquiry |
PSMA1-2780HCL | Recombinant Human PSMA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rh4 Products
Required fields are marked with *
My Review for All Rh4 Products
Required fields are marked with *
0
Inquiry Basket