Recombinant Full Length Drosophila Melanogaster Odorant Receptor Coreceptor(Orco) Protein, His-Tagged
Cat.No. : | RFL1339DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Odorant receptor coreceptor(Orco) Protein (Q9VNB5) (1-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-486) |
Form : | Lyophilized powder |
AA Sequence : | MTTSMQPSKYTGLVADLMPNIRAMKYSGLFMHNFTGGSAFMKKVYSSVHLVFLLMQFTFI LVNMALNAEEVNELSGNTITTLFFTHCITKFIYLAVNQKNFYRTLNIWNQVNTHPLFAES DARYHSIALAKMRKLFFLVMLTTVASATAWTTITFFGDSVKMVVDHETNSSIPVEIPRLP IKSFYPWNASHGMFYMISFAFQIYYVLFSMIHSNLCDVMFCSWLIFACEQLQHLKGIMKP LMELSASLDTYRPNSAALFRSLSANSKSELIHNEEKDPGTDMDMSGIYSSKADWGAQFRA PSTLQSFGGNGGGGNGLVNGANPNGLTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYG AALLLHMLTSTIKLTLLAYQATKINGVNVYAFTVVGYLGYALAQVFHFCIFGNRLIEESS SVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFM VLVQLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Orco |
Synonyms | Orco; A45; Or83b; CG10609; Odorant receptor coreceptor; Odorant receptor 83b |
UniProt ID | Q9VNB5 |
◆ Recombinant Proteins | ||
RALGDS-439H | Recombinant Human RALGDS Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RPS27-4823R | Recombinant Rat RPS27 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21911GF | Recombinant Full Length Chicken Frizzled-6(Fzd6) Protein, His-Tagged | +Inquiry |
MFI2-0393H | Recombinant Human MFI2 protein, His-tagged | +Inquiry |
aroA-5127A | Recombinant Agrobacterium sp. (strain CP4) aroA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-8301S | Native Sheep ALB | +Inquiry |
Adrenal-019H | Human Adrenal Lysate, Total Protein | +Inquiry |
APOA2-4772H | Native Human Apolipoprotein AII protein | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
CA-50-381H | Active Native Human Cancer Antigen 50 | +Inquiry |
◆ Cell & Tissue Lysates | ||
H1FNT-5665HCL | Recombinant Human H1FNT 293 Cell Lysate | +Inquiry |
KLF9-4924HCL | Recombinant Human KLF9 293 Cell Lysate | +Inquiry |
CYP2C18-434HCL | Recombinant Human CYP2C18 cell lysate | +Inquiry |
Heart-766C | Chicken Heart Membrane Lysate, Total Protein | +Inquiry |
MYO5C-1161HCL | Recombinant Human MYO5C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Orco Products
Required fields are marked with *
My Review for All Orco Products
Required fields are marked with *
0
Inquiry Basket