Recombinant Full Length Anopheles Gambiae Gustatory And Odorant Receptor 7(Gpror7) Protein, His-Tagged
Cat.No. : | RFL7445AF |
Product Overview : | Recombinant Full Length Anopheles gambiae Gustatory and odorant receptor 7(GPRor7) Protein (Q7QCC7) (1-478aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anopheles gambiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-478) |
Form : | Lyophilized powder |
AA Sequence : | MQVQPTKYVGLVADLMPNIRLMQASGHFLFRYVTGPILIRKVYSWWTLAMVLIQFFAILG NLATNADDVNELTANTITTLFFTHSVTKFIYFAVNSENFYRTLAIWNQTNTHPLFAESDA RYHSIALAKMRKLLVLVMATTVLSVVAWVTITFFGESVKTVLDKATNETYTVDIPRLPIK SWYPWNAMSGPAYIFSFIYQIYFLLFSMVQSNLADVMFCSWLLLACEQLQHLKGIMRSLM ELSASLDTYRPNSSQLFRAISAGSKSELIINEEKDPDVKDFDLSGIYSSKADWGAQFRAP STLQTFDENGRNGNPNGLTRKQEMMVRSAIKYWVERHKHVVRLVSAIGDTYGPALLLHML TSTIKLTLLAYQATKIDGVNVYGLTVIGYLCYALAQVFLFCIFGNRLIEESSSVMEAAYS CHWYDGSEEAKTFVQIVCQQCQKAMTISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Orco |
Synonyms | Orco; GPRor7; AGAP002560; Odorant receptor coreceptor; AgOr7; Gustatory and odorant receptor 7 |
UniProt ID | Q7QCC7 |
◆ Recombinant Proteins | ||
ANKS4B-1438HF | Recombinant Full Length Human ANKS4B Protein, GST-tagged | +Inquiry |
UBE2D4-3022H | Recombinant Human UBE2D4 protein, His-tagged | +Inquiry |
PCID2-1767Z | Recombinant Zebrafish PCID2 | +Inquiry |
DGKH-2575H | Recombinant Human DGKH Protein, GST-tagged | +Inquiry |
PDGFRA-1633H | Recombinant Human PDGFRA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PLG-1867B | Native Bovine PLG Protein | +Inquiry |
CAT-101B | Active Native Bovine CAT | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
IgG-348G | Native Hamster Gamma Globulin Fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
MUTYH-4052HCL | Recombinant Human MUTYH 293 Cell Lysate | +Inquiry |
KCNA6-353HCL | Recombinant Human KCNA6 lysate | +Inquiry |
TRNT1-749HCL | Recombinant Human TRNT1 293 Cell Lysate | +Inquiry |
ACAA2-9118HCL | Recombinant Human ACAA2 293 Cell Lysate | +Inquiry |
MT1X-4097HCL | Recombinant Human MT1X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Orco Products
Required fields are marked with *
My Review for All Orco Products
Required fields are marked with *
0
Inquiry Basket