Recombinant Full Length Drosophila Melanogaster Odorant Receptor 33C(Or33C) Protein, His-Tagged
Cat.No. : | RFL10066DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Odorant receptor 33c(Or33c) Protein (P81916) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MVIIDSLSFYRPFWICMRLLVPTFFKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPS TAEFFKNLTMSLTCVACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHC HARRFTRCLYISFGMIYALFLFGVFVQVISGNWELLYPAYFPFDLESNRFLGAVALGYQV FSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHK LLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLF PSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELN LNAFFATLKMAYSLFAVVVRAKGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or33c |
Synonyms | Or33c; AN2; DOR33B.3; dor71; Or33B.3; CG5006; Odorant receptor 33c |
UniProt ID | P81916 |
◆ Recombinant Proteins | ||
RFL108CF | Recombinant Full Length Clavispora Lusitaniae Probable Metalloreductase Aim14(Aim14) Protein, His-Tagged | +Inquiry |
FGD3-4090H | Recombinant Human FGD3 Protein, GST-tagged | +Inquiry |
COX17-449 | Recombinant S.cervisiae S.cervisiae COX17 | +Inquiry |
RPOA-0300B | Recombinant Bacillus subtilis RPOA protein, His-tagged | +Inquiry |
RIMI-1929B | Recombinant Bacillus subtilis RIMI protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
RB5200-3281H | Native Human RB5200 | +Inquiry |
Neuraminidase-008C | Active Native Clostridium perfringens Neuraminidase, Type V | +Inquiry |
b-Glucosidase-10S | Active Native Sweet Almonds b-Glucosidase | +Inquiry |
PLG-268B | Active Native Bovine glu-Plasminogen | +Inquiry |
FGG -36D | Native Canine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNAI3-5869HCL | Recombinant Human GNAI3 293 Cell Lysate | +Inquiry |
GNPAT-5843HCL | Recombinant Human GNPAT 293 Cell Lysate | +Inquiry |
WNT5B-291HCL | Recombinant Human WNT5B 293 Cell Lysate | +Inquiry |
ERCC6L-634HCL | Recombinant Human ERCC6L cell lysate | +Inquiry |
CORO2A-7342HCL | Recombinant Human CORO2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Or33c Products
Required fields are marked with *
My Review for All Or33c Products
Required fields are marked with *
0
Inquiry Basket