Recombinant Full Length Drosophila Melanogaster Innexin Inx7(Inx7) Protein, His-Tagged
Cat.No. : | RFL30337DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Innexin inx7(inx7) Protein (Q9V3W6) (1-438aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-438) |
Form : | Lyophilized powder |
AA Sequence : | MLNTFSSVRQYLKFDLTRVVIDNIVFKLHYRWTFVILLVATLLITSRQYIGEHIQCLSDG VVSPVINTFCFFTPTFTVVRDQNQTAYRPGSEPPGIGAFDPEKDTIKRHAYYQWVPFVLF FQALCFYIPHALWKSWEGGRIKALVFGLRMVGLTRYLKNDSLRIGKLNIPSMAEAEERVK DIRRTMIDRMRLNQSWGAHLVFAEVLNLINLLLQITWTNRFLGGQFLTLGPHALKNRWSD ELSVLDLVFPKITKCKFHKFGDSGSIQMHDALCVMALNIMNEKIYIILWFWYAFLLIVTV LGLLWRILTLCFYRNVTFTRWSLYWAKPGQLDENELLAVIDKCNFSNWMFLFFLRSNLSE FLFKKVIYHLASEFPNPDHDNDVNAYREAPPTPAKNRYPELSGLDTIDSPLLHLRRNGSP SAGGAQGPSTSDMAKLPV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Inx7 |
Synonyms | Inx7; prp7; CG2977; Innexin inx7; Innexin-7; Gap junction protein prp7; Pas-related protein 7 |
UniProt ID | Q9V3W6 |
◆ Recombinant Proteins | ||
C5-26131TH | Recombinant Human C5, His-tagged | +Inquiry |
DOK1-129HF | Recombinant Full Length Human DOK1 Protein | +Inquiry |
RFL12420SF | Recombinant Full Length Staphylococcus Aureus Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
SAP050A-003-2305S | Recombinant Staphylococcus aureus (strain: NE 3874) SAP050A_003 protein, His-tagged | +Inquiry |
IL19-406H | Active Recombinant Human IL19, Met-tagged | +Inquiry |
◆ Native Proteins | ||
a-AntiTrypsin-5911H | Active Native Human a-AntiTrypsin | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
ung-8332E | Native E.coli ung | +Inquiry |
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
B4GALT2-8539HCL | Recombinant Human B4GALT2 293 Cell Lysate | +Inquiry |
SPTSSB-8041HCL | Recombinant Human C3orf57 293 Cell Lysate | +Inquiry |
C1orf94-8144HCL | Recombinant Human C1orf94 293 Cell Lysate | +Inquiry |
NA-1743HCL | Recombinant H5N1 NA cell lysate | +Inquiry |
PAX7-3413HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Inx7 Products
Required fields are marked with *
My Review for All Inx7 Products
Required fields are marked with *
0
Inquiry Basket