Recombinant Full Length Drosophila Melanogaster Innexin Inx2(Inx2) Protein, His-Tagged
Cat.No. : | RFL10070DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Innexin inx2(inx2) Protein (Q9V427) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-367) |
Form : | Lyophilized powder |
AA Sequence : | MFDVFGSVKGLLKIDQVCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIP LGVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQA ILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNFYAFRF FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTF HKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRH LLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSREMSGDEHSA HKRPFDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Inx2 |
Synonyms | Inx2; prp33; CG4590; Innexin inx2; Innexin-2; Gap junction protein prp33; Pas-related protein 33 |
UniProt ID | Q9V427 |
◆ Recombinant Proteins | ||
CCBL1-82H | Recombinant Human CCBL1, His-tagged | +Inquiry |
IKZF3-487H | Recombinant Human IKZF3 Protein, MYC/DDK-tagged | +Inquiry |
TTC33-7148H | Recombinant Human Tetratricopeptide Repeat Domain 33, His-tagged | +Inquiry |
CAMK2B1-8262Z | Recombinant Zebrafish CAMK2B1 | +Inquiry |
CYP2C43-185C | Recombinant Cynomolgus Monkey CYP2C43 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HBA2-27786TH | Native Human HBA2 | +Inquiry |
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
Lectin-1855V | Active Native Vicia Villosa Lectin Protein, Agarose bound | +Inquiry |
DES-167C | Native chicken DES | +Inquiry |
Brain-013H | Human Brain Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AURKAIP1-8561HCL | Recombinant Human AURKAIP1 293 Cell Lysate | +Inquiry |
Pancreas-41H | Human Pancreas Tissue Lysate | +Inquiry |
PEPD-3297HCL | Recombinant Human PEPD 293 Cell Lysate | +Inquiry |
G6PC-6082HCL | Recombinant Human G6PC 293 Cell Lysate | +Inquiry |
KCNIP4-5050HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Inx2 Products
Required fields are marked with *
My Review for All Inx2 Products
Required fields are marked with *
0
Inquiry Basket