Recombinant Full Length Drosophila Melanogaster Beta-1,4-Mannosyltransferase Egh(Egh) Protein, His-Tagged
Cat.No. : | RFL11130DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Beta-1,4-mannosyltransferase egh(egh) Protein (O01346) (1-457aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-457) |
Form : | Lyophilized powder |
AA Sequence : | MNSTTKHLLHCTLLITVIVTFEVFSGGIKIDENSFTLVDPWTEYGQLATVLLYLLRFLTL LTLPQVLFNFCGLVFYNAFPEKVVLKGSPLLAPFICIRVVTRGDFPDLVKTNVLRNMNTC LDTGLENFLIEVVTDKAVNLSQHRRIREIVVPKEYKTRTGALFKSRALQYCLEDNVNVLN DSDWIVHLDEETLLTENSVRGIINFVLDGKHPFGQGLITYANENVVNWLTTLADSFRVSD DMGKLRLQFKLFHKPLFSWKGSYVVTQVSAERSVSFDNGIDGSVAEDCFFAMRAFSQGYT FNFIEGEMYEKSPFTLLDFLQQRKRWLQGILLVVHSKMIPFKHKLLLGISVYSWVTMPLS TSNIIFAALYPIPCPNLVDFVCAFIAAINIYMYVFGVIKSFSLYRFGLFRFLACVLGAVC TIPVNVVIENVAVIWGLVGKKHKFYVVQKDVRVLETV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | egh |
Synonyms | egh; l(1)3Ae; zw4; CG9659; Beta-1,4-mannosyltransferase egh; Protein egghead; Protein zeste-white 4 |
UniProt ID | O01346 |
◆ Recombinant Proteins | ||
GSDMB-1024H | Recombinant Human GSDMB Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32294HF | Recombinant Full Length Human 5-Hydroxytryptamine Receptor 5A(Htr5A) Protein, His-Tagged | +Inquiry |
GADD45B-292H | Recombinant Human GADD45B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RNF208-14332M | Recombinant Mouse RNF208 Protein | +Inquiry |
TTC33-625HFL | Active Recombinant Full Length Human TTC33 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-1744M | Active Native Maclura Pomifera Lectin Protein | +Inquiry |
CGB-29186TH | Native Human CGB | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP1-2678HCL | Recombinant Human TIMP1 cell lysate | +Inquiry |
ERBB4-895RCL | Recombinant Rat ERBB4 cell lysate | +Inquiry |
TACSTD2-2546HCL | Recombinant Human TACSTD2 cell lysate | +Inquiry |
PPIL6-2965HCL | Recombinant Human PPIL6 293 Cell Lysate | +Inquiry |
AP2S1-8811HCL | Recombinant Human AP2S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All egh Products
Required fields are marked with *
My Review for All egh Products
Required fields are marked with *
0
Inquiry Basket