Active Recombinant Full Length Human TTC33 Protein, C-Flag-tagged

• Cat.No.: TTC33-625HFL
• Product Overview: Recombinant Full Length Human TTC33 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: TTC33 (Tetratricopeptide Repeat Domain 33) is a Protein Coding gene.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Enzyme substrate
• Molecular Mass: 29.2 kDa
• AA Sequence: MASFGWKRKIGEKVSKVTSQQFEAEAADEKDVVDNDEGNWLHAIKRRKEILLEGCAEKSKQLKDEGASLA ENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAVQQNPHSWESWQTLGRAQLGL GEIILAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKVAQRIKKSEAPAEVTHFSPKSIPDYDFESDE
  IVAVCAAIAEKEKTVSANKTMVIVSASGAIETVTEKEDGATPPDGSVFIKARTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: TTC33 tetratricopeptide repeat domain 33 [ Homo sapiens (human) ]
• Official Symbol: TTC33
• Synonyms: OSRF
• Gene ID: 23548
• mRNA Refseq: NM_012382.3
• Protein Refseq: NP_036514.1
• UniProt ID: Q6PID6